KEGG   Mycobacterium gilvum Spyr1: Mspyr1_36070Help
Entry
Mspyr1_36070      CDS       T01376                                 

Definition
hypothetical protein
Orthology
K16149  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:msp00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3731381..3732976
Genome map
AA seq 531 aa AA seqDB search
MSHADVASGDEKNSVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWSAAYLPLIRVLRT
LAAENRRHLITLGITPVVAAQLDDPYCLQGMNHWLANWQLRALEASTTRSSEPGAPPASQ
PQALRQFGVREYEEAERELGEFDALWRHGASPLFRELLDNQTIELLGGPLAHPFQPLLNP
RLREFALREGLADAHTRFAHRPSGIWAPECAYAPGMEIGYDDAGVTHFMVDGPSLRGDTS
LGRPVGGSDVVAFGRDLQVSYRVWSPKSGYPGHSAYRDFHTYDHATGLKPARVTGRNVPS
DAKAPYDPARADAAVDVHVADFVDTVRRRLAAESERIGRPAHVVAAFDTELFGHWWYEGP
VWLERVLRALPAAGVRVGTLSDAIAEGYVGAPVDLPPSSWGSGKDWQVWSGDQVADLVQL
NSEVVDAALSTVDKALAHGAALGSPTPRDFVADQILRETLLTVSSDWPFMVSKDSAADYA
RYRAHLHAHATREISDALASGRREHAQQLADGWNRADGLFGALDARRLPAT
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
gtgagccacgcagacgtcgcgtctggggacgaaaagaattcggtaccaggacttttcacg
ctggttctgcacacgcatctgccgtggctcgcgcatcacggtcgctggccggtcggcgag
gaatggctctatcagtcctggtcggctgcgtacctgccgctgatacgcgtgctgcgcacg
ctggccgccgagaaccgccgacacctgatcacgctgggcatcaccccggtggtggccgcc
cagttggacgatccgtattgcctgcagggcatgaaccactggctcgcgaactggcaactg
cgggcgctggaggcctcgacgacgcggagctcggagccgggcgccccacccgcatcccag
ccacaggccctgcggcagttcggtgttcgcgagtacgaggaggccgaacgggagctcggt
gagttcgacgcgctctggcgacacggcgcgagcccgttgtttcgcgagctgctcgacaac
cagaccatcgaactgctcggcggcccgctcgctcaccccttccagccactgctgaatcca
cgtctgcgcgagttcgcgctgcgcgagggtctcgccgatgcccacacgcggttcgcccac
cgcccgagcgggatctgggcgccggaatgcgcgtacgcaccggggatggaaatcggctac
gacgacgccggtgtcacccacttcatggtcgacgggccgtcgttgcgcggagacacctcg
ctcggcagaccggtcggcggttccgatgtcgtcgcgttcggtcgcgaccttcaggtgagc
taccgcgtgtggtcgcccaaatcgggatatcccggacacagcgcctaccgcgacttccac
acctacgaccacgccaccgggctcaaacccgctcgggtgaccggacgcaacgtgccctcg
gacgcgaaggcaccctacgatccggcgcgcgccgacgccgcggtggacgtccacgtcgcc
gacttcgtcgacaccgtgcgccggcgcctcgccgccgagagcgaacgcatcggccggccc
gcccatgtcgtcgccgcgttcgacaccgagctgttcgggcactggtggtacgagggcccg
gtctggctggagcgggtgttgcgggcgctgcccgccgccggcgtgcgggtcggcacgctg
tcggatgcgatcgccgagggctacgtcggcgcccctgtcgatctcccaccgagctcgtgg
ggctcgggcaaggactggcaggtgtggtcgggcgaccaggtggccgatctggtgcagctc
aacagcgaggtcgtcgacgcggcgctgagcaccgtggacaaggcactcgcccacggcgcg
gcgttgggttcgcccaccccaagggatttcgtggccgaccagatccttcgcgagaccttg
ttgacggtctcgagtgactggccgttcatggtgagcaaggactccgccgcggactatgcg
cgctaccgcgcccatctgcacgcccacgccacgcgggagatctccgacgcactggcgtcg
ggccgccgcgagcacgcgcagcagctggccgacggctggaatcgcgccgacgggctcttc
ggtgcgctcgacgcccggaggctgccggcgacatga

DBGET integrated database retrieval system