KEGG   Mycobacterium gilvum Spyr1: Mspyr1_36080Help
Entry
Mspyr1_36080      CDS       T01376                                 

Definition
glycosyltransferase
Orthology
K16150  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mspyr1_36080
Enzymes [BR:msp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     Mspyr1_36080
Glycosyltransferases [BR:msp01003]
 Polysaccharide
  Storage polysaccharide
   Mspyr1_36080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3732973..3734205
Genome map
AA seq 410 aa AA seqDB search
MKMKILLVSWEYPPVVIGGLGRHVHHLATELVAAGHEVVVLSRRPTGTDPQTHPTTDETH
EGVRVIAAAEDPHEFGFGTDMMAWVLAMGHSMIRAGFGLDGWRPDIVHAHDWLVAHPAVA
LAQFFDVPLVSTIHATEAGRHSGWVSGSVSRQVHALESWLVRDSDSLITCSASMRDEISA
LFGPELAEISVIPNGIDTDGWPFAARRAHSGPAELLYFGRLEYEKGVHDAIAALPKVRRT
HPGTTLTIAGDGTQLGFLTEQARRHKVLKATKFVGRVDHSQLLTLLHRADVAVLPSHYEP
FGIVALEAAATGTPLVTSTAGGLGEAVIDGVTGMSYPPSDVTALAAAIRAVLDAPAAAQE
RATAARARLTSDFAWHTVAAETAQVYLAAKRAERRPQPRRTIVERPLPDR
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgaagatcctgctggtctcctgggagtacccgccggtggtgatcggcggcctg
ggccggcacgtgcaccatctggccaccgaactcgtcgcggccggccacgaggtggtggtg
ctgagccggcgcccgaccggcacggatccacagacgcatccgaccaccgacgagacgcac
gagggtgtccgggtgatcgccgcggcggaagatccccacgagttcggcttcggcacggac
atgatggcgtgggtgctggccatggggcactcgatgatccgtgcgggtttcggcctcgac
ggctggcgtcccgacatcgtgcacgcccacgactggctcgtcgcccaccctgcggtcgcg
ctggcccaattcttcgacgtgccactggtttcgaccatccacgcgaccgaggccggcagg
cattcggggtgggtctcgggatccgtgagcaggcaggtgcacgccctcgagtcgtggctg
gtgcgcgattccgactcgctgatcacgtgttctgcgtccatgcgcgacgagatcagcgcg
ctgttcggacccgagctcgccgagatctcggtcattcccaacggcatcgacaccgacggc
tggccgttcgcggcgcggcgcgcacactccggaccggcggaactgctgtacttcggacgt
ctcgagtacgagaagggtgtgcacgacgcgatcgcggcgttgcccaaggttcgccgcacc
catcccggtaccaccctgacgatcgccggtgacggcacccagctgggcttcctcaccgag
caggcgcggcgccacaaggtcctcaaggcgacgaaattcgttggcagggttgaccattcc
cagttgctgacgttgttgcatcgcgctgacgtcgcggtgctgccctcgcattacgagccg
ttcggcatcgtcgcgcttgaggccgcggcgaccggcaccccgctggtcacctcgaccgcg
ggcggtctcggcgaggccgtcatcgacggcgtcacgggcatgtcgtatccgccgagcgat
gtgaccgcgctggccgcggccatcagggccgtcctcgacgcgcccgcggccgcgcaggag
cgcgcgacggcggcgcgggcccggctgacctccgacttcgcctggcacaccgtggccgcc
gagacagcgcaggtctacctcgcggccaagcgcgccgagcgacggccgcagccgaggcga
acgatcgtggagcgccccctgccggaccgatga

  All links  
No link information was found.   
DBGET integrated database retrieval system