KEGG   Mycobacterium gilvum Spyr1: Mspyr1_39640Help
Entry
Mspyr1_39640      CDS       T01376                                 

Definition
(GenBank) succinate dehydrogenase/fumarate reductase flavoprotein subunit
  KO
K16051  3-oxo-5alpha-steroid 4-dehydrogenase [EC:1.3.99.5]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
msp00984  Steroid degradation
msp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Mspyr1_39640
Enzymes [BR:msp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With unknown physiological acceptors
    1.3.99.5  3-oxo-5alpha-steroid 4-dehydrogenase (acceptor)
     Mspyr1_39640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 DAO Pyr_redox_2 HI0933_like FAD_oxidored GIDA NAD_binding_8 Thi4
Motif
Other DBs
NCBI-ProteinID: ADU00554
UniProt: E6TNC7
Position
4114853..4116427
Genome map
AA seq 524 aa AA seqDB search
MADEYDVIVVGFGAAGAAAAIEAADRGARVLALDRGYGGGATALSGGIIYAGAGTAEQHA
GGHTDSVDNLRAYLTQEVGDAVGEDTLTRFCAESPGLIEWLKAQGVEFRGGPVSSYKTSY
PTDDFYLYYSGNEKAYPYAQHAAPAPRGHRVLAPGMSSGRVLYERLRDSAKAKGVTVIPL
ARVHGLITDAGRVVGVRYRVLDQGHPNAHRHRVLTRATAKLGTWMPGLVNGVVARAERLW
AEAAVQTEARAPSVILAAGGFIFNREWVQAHAPEFTKISPLCTAGDDGNGITLGLDAGGF
TDKMGNVAAWRFLAPPSAFLEGLTVGADGLRITNEDLYGATHSTVMMREFGGTGWAIYDA
RTWAKIRGQVRTQTQLFQRLQLIYLFTTGHRKSSTLEGLARKNGIDPAGLRRTVDAYNSG
IVSGTGDPAHKDPGLCAPMTTGPFYSIDISAASSMFYPVPGLTLGGLVVDEKTGEVMHRA
GGTVAGLYAVGRTAVGICSNSYVSGLSLSDCVFSGRRAGAHAAG
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgagtacgacgtcatcgtcgtcgggttcggcgccgccggtgcggccgccgcg
atcgaggcggccgaccgcggcgcacgggtcctcgcgctggaccgcggctacggtggcggc
gcgaccgcgttgtccggcgggatcatctacgccggcgcaggcaccgccgaacaacacgcg
ggcggccacaccgattccgtcgacaaccttcgggcctacctcacacaggaggtcggcgac
gcggtcggcgaggacacgctgacacgcttctgtgccgaaagtcccggcctcatcgaatgg
ttgaaggcgcaaggcgtcgagttccgcggtggacccgtgtcgtcgtacaagacgtcctac
cccaccgacgacttctacctctactactcgggcaacgagaaggcctacccctacgcgcag
catgctgccccggcaccgcgcggacaccgcgtgctcgcccccggtatgagttcgggccga
gtgctctacgagcgcctacgggactcggcgaaagccaagggagtcactgtgattccactg
gcccgcgtccacggtctgatcaccgacgccggccgcgtcgtcggggtgcgataccgcgtg
ctggatcagggccaccccaacgcacaccgtcaccgcgtgctgaccagagccaccgcgaaa
ctgggcacgtggatgccgggcctggtcaatggtgtggtggcccgggccgaacggctatgg
gccgaggcagcggtgcagaccgaagcacgcgcgccgtcggtgatcctggccgcgggcggc
ttcatcttcaaccgcgagtgggttcaggcgcacgcgccggagttcacgaagatctccccg
ctgtgcaccgccggcgacgatggcaacgggatcacgctggggctcgacgccggcgggttc
accgacaagatgggcaacgtcgccgcctggcggttcctcgccccgcccagcgcatttctc
gaaggcctcaccgtcggcgccgacggcctccggatcaccaacgaggacctttacggcgcc
acacacagcactgtgatgatgcgcgagttcggcggcaccggatgggcgatctacgacgcg
cgcacatgggcgaagatccgcggtcaggtccggacccagacgcagctgttccagcgtctg
cagttgatctacctgttcaccaccggacaccgcaagagctccaccctggagggtctggcc
cgcaagaacggcatcgacccggccggactgcggcgcaccgtcgatgcctacaactccgga
atcgtctccggtaccggtgatccggcacacaaggaccccggtctgtgtgcgccgatgacg
acgggaccgttctactcgatcgacatctccgcggcgtcgtcgatgttctatccggtcccc
gggctgacgctcggcgggctggtcgtcgacgagaagaccggcgaggtgatgcaccgcgcc
ggtggcaccgtggctgggctgtacgcggtgggacgcaccgcggtcggcatctgctcgaac
agctacgtcagcggactgtcgttgtcggactgcgtcttcagcggccgccgcgccggagca
cacgcggccgggtag

DBGET integrated database retrieval system