KEGG   Mycobacterium gilvum Spyr1: Mspyr1_40650Help
Entry
Mspyr1_40650      CDS       T01376                                 

Definition
coenzyme F420-0 gamma-glutamyl ligase (EC:6.3.2.-)
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Methane metabolism [PATH:msp00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4222456..4223796
Genome map
AA seq 446 aa AA seqDB search
MTDHGTSARVEVLPVPGLPEFRPGDDLAAAIADSAPWLRDDDVVVVTSKVLSKTEGRMVE
APTDPDERDTLRRKLIDGEAVRVLARKGRTLITENALGLVQAAAGVDGSNVDSNELALLP
VDPDGSAAELVAALHERLGVRVAVVVTDTMGRAWRTGQTDVAIGAAGLTVLHAYAGEHDQ
HGNELIVTEIAVADEIAAAADLVKGKLTAVPVAVVRGLAVRDDGSSARNLVRAGEEDLFW
LGTDEALALGRSQAQLLRRSVRQFSPEPVDGALIGAAVGEALTAPAPHHTRPVRFVWVQD
GALRVGLLDEMKERWRADLLADGRDAESVERRVSRGQILYDAPELIIPFMVPDGAHSYPD
ERRTAAEHTMFTVAAGAAVQGLLVALAVRGVGSCWIGSTIFAPELVRAALEVPGDWEPLG
AIAIGYGTDPVTPREPVPTDGLLVRR
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaccacggcacgtcggcacgggtggaggtgctgccggtgccggggctgccggag
ttccggccgggcgacgatctcgcggccgcgatcgccgactcggcgccgtggttgcgcgac
gacgatgtcgtcgtcgtgacgagcaaggtgctgtccaagaccgagggccgcatggtggaa
gcccccaccgatcccgacgagcgggacacgctgcgccgcaagctgatcgacggtgaggcc
gtgcgggtgctggcgcgcaagggccgcacgctgatcaccgagaacgcgctcggcctggtg
caggccgcggccggggtggacggctccaacgtcgactcgaacgaattggcgctgctgccg
gtcgatcccgacggcagcgcggcggaactggtcgcggcgctgcacgaacggctcggcgtg
cgggtggccgtcgtcgtcaccgacacgatgggccgcgcgtggcggaccgggcagaccgac
gtcgcgatcggcgcggccgggctcacggtgttgcacgcctacgccggtgagcacgatcag
cacggcaacgagttgatcgtcaccgagatcgcggttgccgacgagatcgccgcggccgcg
gatctggtgaagggcaagctgaccgcggtgccggtcgccgtggtgcggggtctcgccgtg
cgcgacgacgggtcctcggcgcgcaacctggtgcgggccggcgaggaggacctgttctgg
ctcggcaccgacgaggcgttggcactgggacgttcgcaggcccagctgctgcgcagatcg
gtgcggcagttcagtcccgaaccggtggacggtgctctgatcggggccgcggtcggtgag
gcgttgaccgctccggcaccgcaccacacgcggccggtgcgcttcgtgtgggtgcaggac
ggtgcgctgcgggtcgggttgctcgacgagatgaaggagcgctggcgcgcggaccttctc
gccgacggacgcgacgccgagtcggtcgagcgacgggtgtcgcgcgggcagatcctctac
gacgcgccggaactgatcattccgttcatggttcccgacggggcgcactcctaccccgac
gagcggcggaccgcggccgagcacacgatgttcacggtcgcggccggcgccgcggtgcag
ggtctgctggtcgcgctcgcagtgcgcggggtgggcagctgctggatcgggtcgacgatc
ttcgccccggagttggtgcgcgcagcgttggaggtgcccggcgattgggagccgttgggc
gccatcgcgatcgggtacgggaccgacccggtgactccgagggagccggtgccgacggac
gggctgctggtgcggcgatga

DBGET integrated database retrieval system