KEGG   Mycobacterium gilvum Spyr1: Mspyr1_42110Help
Entry
Mspyr1_42110      CDS       T01376                                 

Definition
cytochrome P450
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    Mspyr1_42110
  Amino acid metabolism
   00380 Tryptophan metabolism
    Mspyr1_42110
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Mspyr1_42110
Enzymes [BR:msp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     Mspyr1_42110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4362263..4363588)
Genome map
AA seq 441 aa AA seqDB search
MPVVGDVFGFSADILTRPPSDPGLGPVFEFRFLGARYVVAASAAAVAEVNDERRFCKHVG
PDIDALRIMGGDGLFTAYNDEPNWQRAHDLLMPAFSQQAMRGYHSAMLDAADGLVARWDG
KARTGASVDVPADATRVTLETIGQCAAGHSFGCFDTEDPHPFVEHMVAGLKGSDWVGVLR
ETFLPNYFARRAERRVRRHAVQMHRIADEIVSERLRDGLGHHDDLLELMLTSELDPANIR
YQLINFLVAGHETTSGALSFALYFLSRHPEVADRARAEVAEVWGDDERPEFELIAKLRYV
RRVLDEALRLQPTVPGYYREAREDTVLAGVHPMRQGDWVLAMTMALHRDPQWGGDPDAFD
PDRFAPDRVRARPAGLYKPFGTGPRSCIGRQFALHEAVLLLAVLLRRYDLVPEPGYQLQV
AQRLTLMPKDFRLTLRRRRSE
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgtcgtcggtgatgtgttcggtttcagcgccgacatcctcacccggccgccgtcg
gaccccggactcggcccggtcttcgaattccgtttcctgggagcgcgatacgtggtcgcc
gcgagtgcggccgccgtcgccgaggtcaacgacgagcgccgcttctgcaaacacgtcggc
cccgacatcgacgcactacggatcatgggtggcgacgggctgttcaccgcgtacaacgac
gaaccgaattggcaacgggcccatgaccttctgatgccagcgttcagtcaacaggcgatg
cggggttatcactcggcgatgctggacgcggccgacggactcgtcgcccgttgggatggt
aaagcgcgcaccggcgcatcggtcgacgtcccggccgacgcgacccgggtgacgctggaa
accatcggacagtgcgcggcgggtcattccttcggctgcttcgacaccgaggacccccac
ccgttcgtcgagcacatggtcgccgggctcaagggctccgactgggtgggagtgctccgg
gagacgttcctgccgaactactttgcgcgccgcgccgaacgtcgggtgcgacgccacgca
gtgcagatgcaccgcatcgccgacgagatcgtctccgaacgccttcgcgacggactcggg
caccacgatgatctgctcgagctgatgctgacctctgagctggatccggccaacatccgc
taccagttgatcaactttctggtcgcgggtcacgaaacaacctcgggtgcactgtctttc
gcactgtacttcctgtcccggcatcccgaggtggcggaccgggcgcgtgcggaggtcgcc
gaggtatggggtgacgacgagcgtcccgagttcgagttgatcgccaaactgcgctatgtg
cgacgggtgctggacgaggcgctgcggctgcagccgaccgtgccggggtactaccgcgag
gcgcgtgaggacacggtgctggccggcgtgcatccgatgcgccagggcgactgggtgctg
gcgatgacgatggcgctgcaccgggatccgcagtggggcggcgatccggatgcgttcgat
cccgaccggttcgcacccgaccgtgtccgggcacgtccggcgggtctgtacaaaccgttc
ggcacggggccgcgatcgtgcatcggccggcagttcgcgctccacgaagcggtgctgctg
ttggcggtgctgctgcgcaggtacgacctcgtccccgagccgggctatcagctccaggtc
gcgcagcggctgaccctgatgcccaaggactttcgcctcacactgcgccggcggcggtca
gagtga

DBGET integrated database retrieval system