KEGG   Mycobacterium gilvum Spyr1: Mspyr1_42520Help
Entry
Mspyr1_42520      CDS       T01376                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Mspyr1_42520
Enzymes [BR:msp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Mspyr1_42520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4407738..4409069)
Genome map
AA seq 443 aa AA seqDB search
MSFDAAGPISHLDAPSVIRTKRDGGALSDEAIDWVIDAYTRGEVAEAQMSALLMAIFLRG
MTGHEIARWTAAMIASGERLDFSDLRRDGKPLALVDKHSTGGVGDKITIPLVPVVMACGG
AVPQAAGRGLGHTGGTLDKLESIPGFTAEITKSQIRQQLCDLGAAIFAAGELAPADRKIY
ALRDVTATTESLPLIASSVMSKKIAEGTKALVLDSKVGSGAFLDSEAESRELARTMVELG
VEHGVQTRALLTDMQTPLGRTVGNAVEVVESLEVLAGGGPDDVVELTLALAREMCDVAGL
DGVDPAQTLRDGTAMDRFRDLVAAQGGDVDSLDAAMLPLGQHTETISAPRSGTMGDIDAM
AVGLAVWRLGAGRSVPGEQVQFGAGMRIHRKPGEAVAAGEPLFTLYTETPHRLAAAASEL
DGAWSVGDHAPPTRPLIIDRISM
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
gtgagcttcgacgccgccggccccatctcgcatctcgatgctccgtcggtgatccgaacg
aagcgcgatggtggagccctgtccgacgaggccatcgactgggtcatcgacgcctacacg
cgcggggaggtcgccgaggcgcagatgtccgcgctgctgatggcgatcttcctccggggt
atgaccggccatgagatcgcgcggtggaccgcggcgatgatcgcgtcgggcgagcgactg
gacttcagcgacctgcgccgggacgggaaaccgctcgcgctggtcgacaaacactcgaca
ggcggtgtcggggacaagatcacgatcccgttggtaccggtcgtcatggcgtgtggcggc
gcggtaccgcaggcggccgggcgtggactcggacacaccggtggcacgctcgacaaactg
gaatccatcccggggttcaccgccgagatcaccaaaagccagatccggcaacaactctgc
gatctcggggcggcgatcttcgccgccggggaattggcgcccgccgaccgcaagatctac
gccctgcgtgacgtgacggcgacgacggagtcgctgccgttgatcgcgagctcggtgatg
agcaagaagatcgccgaggggacgaaggcgctggtgctcgactccaaggtcgggtcgggt
gcgttcctcgacagtgaggccgagtcgcgggagttggctcgcaccatggtcgagctcggc
gtcgagcacggtgtgcagacccgcgcgctgctcaccgacatgcagaccccgctgggccgg
accgtcggcaacgccgtcgaggtcgtcgagtccctggaggtgctcgccggcggcggaccc
gacgatgtcgtggagctgaccctggcgttggcgagggagatgtgcgacgtcgcagggctc
gacggcgtcgaccccgcgcagacgttgcgcgacgggaccgcgatggaccggttccgcgac
ctggtcgccgcccagggtggcgacgtggacagtctcgatgccgcgatgttgccactcggt
cagcacaccgaaaccatcagtgccccgcgcagtggcacgatgggagacatcgacgcgatg
gcggtgggtctggcggtgtggcggctcggagcgggacgctcggtacccggcgagcaggtg
cagttcggcgcggggatgcggatccatcgcaaacccggcgaggccgtcgccgccggcgag
ccgctgttcaccctctacaccgagaccccgcaccggcttgccgccgcggcgtccgaactc
gacggcgcctggagcgtcggcgaccacgcaccgcccacgcgtccactcatcatcgaccgg
atcagcatgtag

DBGET integrated database retrieval system