KEGG   Mycobacterium gilvum Spyr1: Mspyr1_42550Help
Entry
Mspyr1_42550      CDS       T01376                                 

Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
msp00020  Citrate cycle (TCA cycle)
msp00190  Oxidative phosphorylation
msp00650  Butanoate metabolism
msp01100  Metabolic pathways
msp01110  Biosynthesis of secondary metabolites
msp01120  Microbial metabolism in diverse environments
msp01130  Biosynthesis of antibiotics
msp01200  Carbon metabolism
Module
msp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
msp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
msp_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mspyr1_42550
   00650 Butanoate metabolism
    Mspyr1_42550
  Energy metabolism
   00190 Oxidative phosphorylation
    Mspyr1_42550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ADU00816
UniProt: E6TCJ0
Position
4410131..4410634
Genome map
AA seq 167 aa AA seqDB search
MTQASRPASGRAENAYDHISDRGGPAPVMQRSFDRPAGLDNPRAPRRSGGMPNFEKYTWL
FMRFSGIVLVFLALGHLFIMLMWESGVYRIDFNYVAQRWSSPFWQTWDLLLLWLAQLHGG
NGMRTIIADYTRKDSTKFWLNTLLALSMAFTLVLGTYVLLTFDASIS
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
gtgactcaggcaagccgtccggcctccggccgggccgaaaacgcgtacgaccacatctcc
gatcgcggtggacccgccccggtgatgcagcgcagcttcgaccgccccgccgggctggac
aacccgcgcgcgccgcgccgctccggcgggatgccgaacttcgagaagtacacctggctg
ttcatgcggttctcgggcatcgtgctcgtgtttctcgccctgggccacctcttcatcatg
ttgatgtgggagagcggtgtgtaccgcatcgacttcaactacgtcgcgcagcgctggtcg
tcgccgttctggcagacctgggacctgctgctgctgtggctggcccagctgcacggcggc
aacgggatgcgcacgatcatcgccgactacacgcgcaaggactcgacgaagttctggctc
aatactctgctcgcgctgtcgatggcgttcacgctggtcctggggacctacgtgctgctg
acgttcgacgcgtcgatttcctga

DBGET integrated database retrieval system