KEGG   Mycobacterium gilvum Spyr1: Mspyr1_42550Help
Entry
Mspyr1_42550      CDS       T01376                                 

Definition
succinate dehydrogenase subunit D (EC:1.3.5.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mspyr1_42550
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mspyr1_42550
   00650 Butanoate metabolism
    Mspyr1_42550
  Energy metabolism
   00190 Oxidative phosphorylation
    Mspyr1_42550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4410131..4410634
Genome map
AA seq 167 aa AA seqDB search
MTQASRPASGRAENAYDHISDRGGPAPVMQRSFDRPAGLDNPRAPRRSGGMPNFEKYTWL
FMRFSGIVLVFLALGHLFIMLMWESGVYRIDFNYVAQRWSSPFWQTWDLLLLWLAQLHGG
NGMRTIIADYTRKDSTKFWLNTLLALSMAFTLVLGTYVLLTFDASIS
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
gtgactcaggcaagccgtccggcctccggccgggccgaaaacgcgtacgaccacatctcc
gatcgcggtggacccgccccggtgatgcagcgcagcttcgaccgccccgccgggctggac
aacccgcgcgcgccgcgccgctccggcgggatgccgaacttcgagaagtacacctggctg
ttcatgcggttctcgggcatcgtgctcgtgtttctcgccctgggccacctcttcatcatg
ttgatgtgggagagcggtgtgtaccgcatcgacttcaactacgtcgcgcagcgctggtcg
tcgccgttctggcagacctgggacctgctgctgctgtggctggcccagctgcacggcggc
aacgggatgcgcacgatcatcgccgactacacgcgcaaggactcgacgaagttctggctc
aatactctgctcgcgctgtcgatggcgttcacgctggtcctggggacctacgtgctgctg
acgttcgacgcgtcgatttcctga

DBGET integrated database retrieval system