KEGG   Mycobacterium gilvum Spyr1: Mspyr1_43230Help
Entry
Mspyr1_43230      CDS       T01376                                 

Definition
choline dehydrogenase-like flavoprotein
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
Steroid degradation
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation [PATH:msp00984]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4488015..4489751)
Genome map
AA seq 578 aa AA seqDB search
MRPDYDVLIIGSGFGGSVSALRLTEKGYRVGVLEAGRRYADDEFAKTSWNLRKFLWAPQF
GMYGIQRIHLLRNVMILAGAGVGGGSLNYANTLYVPPEPFFNDPQWRDITDWRAELMSHY
DQAQRMLGVVTNPTFTDADRIMKEVADDMGVGDTFVPTPVGVFFGPDGEKTPGKTVADPY
FGGAGPARTGCIECGSCMTGCRYGAKNTLVKNYLGLAEKAGAQVHPLTMVTGFEQRPDGL
WEVHTARTGSKVRRRRKTFTAEHVILAAGTYGTQKLLFKMRDRGKLPKLSDKLGVLTRTN
SESIVGAGRLTVGDDLNLTHGVAITSSIHPTADTHVEPVRYGKGSNAMGLLQTLMTDGTG
PEGTDVPRWRQLLDTARNDRKGTLRLLNPRRWSERTMIALVMQHLDNSITTYTRKTKFGF
RMLDSKQGHGEPNPSWIPAGNEVTRRIAEKIDGVAGGTWGELFNIPLTAHFLGGAAIADS
PERGVIDPYQRVWNYPTLSVMDGAAVSANLGVNPSLSITAQAERAAALWPNKGEEDLRPE
QGQPYRRLSPIEPKHPVVPADAPAALRRIPIEPVTSAG
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgaggcctgactacgacgtgctgatcatcggttcggggttcggcggcagcgtcagcgcg
ctgcgactgaccgagaagggttaccgcgtcggcgtgctggaagcgggtcgccgctacgcc
gacgacgagttcgcgaagacctcgtggaacctccgcaagttcctgtgggcgccgcagttc
ggcatgtacggcattcagcgcattcatctgctgcgcaacgtgatgatcctggccggcgcg
ggtgtcggaggcggatccctgaactacgccaacacgctctatgttccgccggagccgttc
ttcaacgatccgcagtggcgtgacatcaccgactggcgggccgagttgatgtcgcactac
gaccaggcgcagcggatgctgggcgtggtcaccaacccgaccttcaccgatgctgaccgc
atcatgaaagaggtcgccgacgacatgggtgtcggcgacacgttcgtgccgacgccggtc
ggcgtgttcttcgggcccgacggcgagaagacgcccggcaagaccgtcgccgacccgtac
ttcggcggtgccggtcccgcccgcacggggtgcatcgagtgcgggtcctgcatgacgggc
tgccggtacggcgcgaagaacaccctggtgaagaactatctggggttggcggagaaggcc
ggtgcccaggtgcacccgctgaccatggtgaccgggttcgagcagcggcccgacggtctg
tgggaggtgcacaccgcccgcaccggcagcaaggtgcgccggcgtcgcaagaccttcacc
gccgagcacgtcatcctggccgccggcacgtacggcacgcagaagctgctgttcaagatg
cgcgaccgcggcaagctgcccaagctctcggacaagctcggtgtgctgacacgcaccaac
tccgagtccatcgtcggcgccggacgcttgaccgtcggggacgacctgaacctgacccac
ggtgtggcgatcacgtcgtcgatccaccccaccgccgacacccacgtcgagccggtgcgc
tacggcaagggttccaacgcgatgggcctgctgcagacgctgatgaccgacggcaccggc
cccgagggcaccgacgtgccgcggtggcggcagctgctcgacaccgcgcgcaacgaccgc
aagggcacgctgcggctgctcaacccgcggcgctggagcgagcgcacgatgatcgcgctc
gtcatgcaacacctcgacaactcgatcacgacctacacccgcaagacgaagttcgggttc
cgcatgctcgacagcaagcagggccacggtgagcccaacccgagctggatcccggccggc
aacgaggtgacccggcgcatcgccgagaagatcgacggcgtcgcgggcggcacctgggga
gaactgttcaacattccgctcaccgcgcacttcctcggcggcgcggcgattgccgactcc
ccggagcgcggtgtcatcgacccgtaccagcgggtgtggaactacccgacgctgtcggtg
atggacggcgccgcggtctcggcgaacctcggggtgaacccgtcgctgtcgatcaccgcg
caggccgagcgcgccgcggcgctgtggccgaacaagggtgaggaggatctgcggcccgag
caggggcagccctaccggcggctgtcgccgatcgagccgaagcatccggtcgtgcctgcc
gatgctccggcggcgctgcgcaggatcccgatcgagcccgtgacttcggccggctag

DBGET integrated database retrieval system