KEGG   Mycobacterium gilvum Spyr1: Mspyr1_44050Help
Entry
Mspyr1_44050      CDS       T01376                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mspyr1_44050
   01230 Biosynthesis of amino acids
    Mspyr1_44050
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mspyr1_44050
   00030 Pentose phosphate pathway
    Mspyr1_44050
   00051 Fructose and mannose metabolism
    Mspyr1_44050
   00052 Galactose metabolism
    Mspyr1_44050
  Energy metabolism
   00680 Methane metabolism
    Mspyr1_44050
Enzymes [BR:msp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Mspyr1_44050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4562735..4563682)
Genome map
AA seq 315 aa AA seqDB search
MSGTAAIVTLTMNTALDVTADADNVVPTEKIRCRAERYDAGGGGVNVARFAHALGAPVSA
VFTAGGSTGARVIDLVHATGVCEIPVLIEGGTRESFTVNDRASGRQYRFVLPGPVLSLGE
QARCLEALRRAAGTAGIVVASGSLPPGVPPDFYQRVADICSDVGAMLVLDTSGGGLRHVT
SGVHLLKPSIRELRECLDRPLHTEPEQIAAARELIDRGAAKVVVVSLGADGALLVTPDDS
ERLSAVPMTSVSCVGAGDALVAGVAVGLARRWPLGRAVRFGIAAASAKLQTPGTAAFHRD
DVERYFVTQAAHSEA
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcacggctgcgatcgtgacgttgacgatgaacaccgcgctcgacgtcaccgcc
gatgcggacaatgtcgttccgacggagaagatccgttgtcgcgcagagcgatacgatgcc
ggcggcggtggggtcaacgtggcccgcttcgcccacgcactgggtgccccggtgtcggcg
gtgttcaccgccggtggatccaccggcgcccgcgtgatcgacctcgtgcatgccaccggg
gtctgcgagattccggtcctcatcgagggtggcacccgggagagcttcaccgtcaacgat
cgggccagtggtcggcagtatcgcttcgtactccccggtcccgtgctcagtctcggtgaa
caggcgcggtgcctggaggcgcttcgacgcgctgcgggcacagccgggatcgtcgtcgcg
agcggaagccttccgccgggggtgccgcccgacttctatcagcgtgtcgccgacatctgc
agtgacgtcggcgcaatgctggttctggacacgtccggaggcggattgcgccacgtcacc
tccggggtgcacctgctcaagccgagcatccgggagcttcgcgaatgcctggatcggccg
ctgcacacggaacccgaacaaatcgccgccgcacgcgaactcatcgaccgaggtgcggcc
aaagttgtggtggtgtctctgggcgcagacggggcactgctggtcacacccgatgacagc
gaacgcctttcagccgtcccgatgacctcggtcagttgtgtgggcgcgggcgatgcgctg
gtcgccggagtcgccgtcgggcttgcgcgccgctggcccctcgggcgggcggtgcggttc
ggaatcgccgccgcctcagcgaagctgcagacgccgggcaccgcggcgttccaccgcgac
gacgtcgagcgctatttcgtcacgcaggcggcacattcggaggcctga

DBGET integrated database retrieval system