KEGG   Mycobacterium gilvum Spyr1: Mspyr1_45190Help
Entry
Mspyr1_45190      CDS       T01376                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
msp00010  Glycolysis / Gluconeogenesis
msp00052  Galactose metabolism
msp00500  Starch and sucrose metabolism
msp00520  Amino sugar and nucleotide sugar metabolism
msp00521  Streptomycin biosynthesis
msp01100  Metabolic pathways
msp01110  Biosynthesis of secondary metabolites
msp01120  Microbial metabolism in diverse environments
msp01130  Biosynthesis of antibiotics
msp01200  Carbon metabolism
Module
msp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
msp_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mspyr1_45190
   00052 Galactose metabolism
    Mspyr1_45190
   00500 Starch and sucrose metabolism
    Mspyr1_45190
   00520 Amino sugar and nucleotide sugar metabolism
    Mspyr1_45190
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mspyr1_45190
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Mspyr1_45190
Enzymes [BR:msp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Mspyr1_45190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: ADU01074
UniProt: E6TF28
Position
complement(4679910..4680821)
Genome map
AA seq 303 aa AA seqDB search
MSDLTLALDIGGTKLAAGLVDADGNLVHRAQTPTPDGDPEILWAAVASLLTDVRSAAEAT
IGAVGIASAGPVDVPAGTVSPINITEWHRFPIVERVETATGLPAYLGGDGLCMAMGEWWR
GAGRGRRSLLGMVVSTGIGGGLVLDGAPFHGRTGNAGHVGHVVVEPDGDACTCGGRGCVE
TVASGPHLARWARTHGWAGADARQLAEDAAGGDEVALRAFARGADAVARTIASVAAVCDL
DLVVVGGGVAKSGALLFDPLRASLQTYAGLDFLRGLQVVAAELGGDAGLVGAAALAAHHG
RFG
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacctcactctggctctcgacatcggcggaaccaagctcgccgcgggtctcgtc
gacgccgacggcaacctcgtgcaccgcgcgcagaccccgacccccgacggggaccccgaa
attctctgggccgccgtcgcgtcattgttgaccgacgtccggtcggccgccgaggcgacc
atcggcgcggtgggcatcgcgtcggccggccccgtcgacgttcccgccggaaccgtcagc
ccgatcaacatcaccgagtggcaccggttcccgatcgtcgagcgcgtcgagacggcgacc
ggcctgccggcgtacctcggcggggacggcctgtgcatggcgatgggcgagtggtggcgc
ggcgcgggcagaggccgacgatccctgctggggatggtggtgtcgaccggtatcggcggc
ggactcgtcctcgacggcgcgccgtttcacggcaggaccggaaacgccggacatgtcggc
cacgtcgtcgtcgaacccgacggcgacgcatgtacctgcggtggccgcggttgcgtcgag
acggtcgcgtcgggtccccatctggcgcgctgggcccgcacccacggctgggcgggggcc
gacgcccgtcagctcgccgaggacgccgccggcggtgacgaggtcgcactgcgcgcgttc
gcccggggtgccgacgccgtcgcgcgcacgatcgcgtcggtggcggccgtgtgcgacctc
gacctcgtcgtggtcggcggcggggtcgcgaagtccggggcgctgttgttcgaccccctg
cgcgcatcgctgcagacctatgcggggctggacttcctccggggcctgcaggtggtcgcg
gccgaactcggcggcgacgcaggtctggtcggcgcggccgcgctggccgcccatcacggc
cgttttggctga

DBGET integrated database retrieval system