KEGG   Mycobacterium gilvum Spyr1: Mspyr1_45510Help
Entry
Mspyr1_45510      CDS       T01376                                 

Definition
DNA helicase/exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:msp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Mspyr1_45510
Enzymes [BR:msp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Mspyr1_45510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4711364..4713031
Genome map
AA seq 555 aa AA seqDB search
MSLDAFAEVFEPADIHVAQRLTELGRDSDPTVALAVALAVRAVRSGSVCVDLRTVAAQVG
VPELPWPDPDGWLSTVGASPLAEHKVVRLDGDLLYLDRYWREEEQVRDDVVALLSSPPRT
AVPGLERLFPAGWEEQRAAAEAALTRSLTVLTGGPGTGKTTTVARLLAAFAEQAELAGGP
PPRMALAAPTGKAAARLQDAVQAEVDRLSAVDRARLAGLRATTMHRLLGSRPDTSSRFRH
HRGNRLPHDVIVVDETSMVSLTMMARLLEAVRPDTRLLFVGDPDQLASVDAGAVLADLVD
GLGEAGVVELTTSHRFGERIGALALAIRSGDADATVEVLRAGGDAIGWLDTDDAADALRG
PLVDRAADLREAALLGDGETALRILDGHRLLCAHRRGPFGVAHWNRQIERWLAERTGQSI
WSQPYAGRPLLVTANDYGLGVYNGDTGVVVAAPEGLRAHIGTPASSRELAVGRLGEVETM
FAMTIHKSQGSQADEVTVLMPPQDSRLLTRELFYTAVTRAKERVQVVGTEASVRAAVGRR
AVRASGLARRLSTAR
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcgacgcgttcgccgaggtgttcgagccggccgatatccatgtggcgcaacgt
ctcaccgagctcggccgggactccgacccgaccgtcgcgctcgcggtggcgctggcggtg
cgggccgtgcgcagcggttcggtgtgcgtggatctgcggaccgtggccgctcaggtcggc
gttcccgagttgccctggccggacccggacggctggctctcgaccgtcggggccagtccc
ctcgccgagcacaaggtggtgcgcctcgacggtgatctgctctacctcgaccggtactgg
cgcgaggaggagcaggtgcgcgacgacgtggtggcgctgctgtcgtcgccgccgcggacg
gcggtgcccggcctggaacggttgttcccggccggctgggaggagcaacgcgcggctgcc
gaggcggcgctgacgcggtcgctgaccgtgctgaccggaggtccgggcaccggcaagacg
acgaccgtggcccggctgctggccgcgttcgccgagcaggccgagctcgccgggggtcca
ccgccgcggatggcgctggccgccccgaccggcaaggccgcggcgcggctgcaggatgcg
gtgcaggccgaggtggaccggctctcggcggtcgatcgcgcccggctcgcggggctgcgc
gcgacgacgatgcaccggttgctcggcagccggccggacacgtcgtcgcggttccgccac
caccgcggcaaccggctgccgcacgacgtgatcgtcgtcgacgagacctcgatggtgtcg
ctgacgatgatggcgcggctgctggaggcggtgcgccccgacacccggctgttgttcgtc
ggcgatcccgaccagctcgcgtcggtggacgccggcgccgtgctcgccgacctggtcgac
ggtctcggtgaggccggggtcgtcgagttgaccacctcgcaccggttcggcgagcggatc
ggcgcgctggcgctcgcgatccgcagcggcgacgccgatgcgaccgtcgaggtgctgcgc
gccggcggggacgcgatcggctggctcgacaccgacgacgcggccgacgcgctgcgcggc
ccgctcgtcgaccgcgccgcggacctgcgcgaggcggcgcttctcggcgacggggagacc
gcgttgcgcattctcgacgggcaccggttgctgtgcgcgcaccgccggggaccgttcggg
gtcgcccactggaaccggcagatcgagcggtggctcgcggagcggaccgggcagtcgatc
tggtcgcagccctacgccgggcgtccgctgctggtgacggcgaacgactacgggctgggc
gtctacaacggcgacacgggcgtcgtcgtcgccgcgccggaggggctgcgcgcccacatc
ggcacgccggcgtcgtcgcgggagctggcggtgggccgcctcggtgaggtcgagacgatg
ttcgcgatgacgatccacaagagtcagggcagccaggccgacgaggtcacggtgctgatg
cctccgcaggactcccggctgctgacccgcgagttgttctacaccgccgtcacccgcgcc
aaggaacgggtgcaggtcgtcgggaccgaggcctcggtgcgggcggcggtcggacgccgc
gcggtgcgcgcatcggggctggcgcggcgcttgagcaccgcccgctga

DBGET integrated database retrieval system