KEGG   Mycobacterium gilvum Spyr1: Mspyr1_46950Help
Entry
Mspyr1_46950      CDS       T01376                                 

Definition
hypothetical protein
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Mspyr1_46950
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Mspyr1_46950
Enzymes [BR:msp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Mspyr1_46950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4880562..4881323)
Genome map
AA seq 253 aa AA seqDB search
MSESGVNDLRSRTAVVTGGAGGIGAACAKALAERGVTVTVADIDEVGAKTVAEEIGGKAW
ALDLLDVAALESLQLETDILVNNAGVQNISEIAEFPPEKFRSMMALMVEAPFLLIRAALP
HMYRNEFGRVINISSIHGLRASPFKVAYVTAKHALEGLSKVTALEGGPHGVTSNCVNPGY
VRTPLVTKQIADQARTHGIPEDQVVSDILLKESAVKRLVGPEEVGSLVAWLASPAAGMVT
GASYTMDGGWSAR
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagtcgggtgtcaacgacctccgcagccgcaccgcagtggtcaccggcggcgcc
ggtggcatcggggcggcgtgcgcgaaggccctcgccgaacgcggtgtcacggtcaccgtc
gccgacatcgacgaggtgggcgccaagacggtggccgaggagatcggcggaaaggcttgg
gcgctggaccttctcgacgtcgctgccctcgagagtctgcagttggagaccgacatcctg
gtcaacaacgccggagtccagaacatcagcgagatcgcggagttcccacccgagaagttc
cgctcgatgatggcgctgatggtcgaggcgccgtttctgctgatccgtgccgcactaccg
cacatgtaccgcaacgagttcggccgcgtcatcaacatctcgtcgatccacggcctgcgt
gcgtcgccgttcaaggtcgcctatgtgacggccaagcacgcgctggaagggctgtccaag
gtgacggcgctcgaaggcggaccgcacggcgtcacgagcaactgcgtcaaccccggatac
gtccgtaccccgctggtgaccaagcagatcgcggatcaggccaggacgcacggcatcccg
gaggaccaggtggtctccgacatcctgctcaaggagagcgcggtcaagcggctcgtcggg
ccggaggaggtcggctcactggtggcgtggctggcctcgcccgcggccgggatggtcacc
ggcgcgtcgtacaccatggacggcggatggagcgctcggtga

  All links  
No link information was found.   
DBGET integrated database retrieval system