KEGG   Mycobacterium gilvum Spyr1: Mspyr1_47530Help
Entry
Mspyr1_47530      CDS       T01376                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mspyr1_47530
Enzymes [BR:msp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Mspyr1_47530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4933402..4934226)
Genome map
AA seq 274 aa AA seqDB search
MTCAVQVMGVVNVTDDSFSDGGLFLDRDRAVAHGVELVAQGAAIIDVGGESTRPGATRVD
PEVEISRILPVVKELAQQGITVSIDTMHAAVAHAALDSGAKIVNDVSGGRADPDMVRVVA
DAGVPWILMHWRSVDGDNPHEVPAYGDVVAEVRDELLSGVDAAVAAGVHPDKLIIDPGLG
FAKTGQHNWALLHALPDFVSTGIPVLVGASRKRFLGTLLAAPDGEPRPPAGRETATAVIS
ALAGWHDVWGVRVHDVRASVDALAVVAAWRGGAS
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
gtgacctgtgccgtgcaggtgatgggcgtcgtcaacgtcaccgacgattcgttctccgac
ggtgggctgttcctggatcgcgaccgcgccgtcgcgcacggggtcgaactcgtcgcccag
ggtgcggcgatcatcgacgtcggtggcgagtcgacccgtcccggcgccacccgcgtcgac
cccgaggtggagatctcgaggatcctgccggtcgtcaaagagcttgcccagcaagggatc
accgtcagcatcgacaccatgcacgcggcggtggcgcatgcggcgctggacagcggggcg
aagatcgtcaacgacgtctccgggggccgggccgatcccgacatggtgcgggtggtcgcc
gatgccggcgtgccgtggatcctcatgcactggcggtcggtggacggcgacaacccgcac
gaggtcccggcgtacggcgacgtcgtcgcggaggtgcgcgacgaactgctcagcggcgtg
gacgcggcggtggccgcgggcgtgcaccccgacaagctgatcatcgacccgggcctcggt
ttcgccaagacaggacaacacaattgggcgttgctccacgcgttgccggatttcgtctcg
acggggatcccggtgctcgtcggcgcatcccgcaaacgcttcctcggaaccctgctcgcc
gcgcccgacggcgaaccgcgcccgccggccgggcgggagaccgcgacggcggtcatctcg
gcgctggccggctggcacgacgtctggggtgtgcgggtgcatgacgtccgcgcgtcggtg
gacgcgctcgcggtggtggcggcgtggcggggcggggcctcatga

DBGET integrated database retrieval system