KEGG   Mycobacterium gilvum Spyr1: Mspyr1_47540Help
Entry
Mspyr1_47540      CDS       T01376                                 

Definition
(RefSeq) GTP cyclohydrolase I (EC:3.5.4.16)
  KO
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mspyr1_47540
Enzymes [BR:msp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Mspyr1_47540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4934223..4934831)
Genome map
AA seq 202 aa AA seqDB search
MTRSHNHSATLTTPDFDQARAEAAVRELLIAVGEDPDREGLRDTPARVARSYREIFAGLY
TDPDEVLTTMFDEQHDEMVLVKDIPMYSTCEHHLVSFHGVAHVGYIPGVDGRVTGLSKLA
RVVDLYAKRPQVQERLTAQIADALMRKLDPRGAIVVIEAEHLCMAMRGIRKPGAVTTTSA
VRGQFKTDKASRAEALDLILRK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgacgcggtcgcacaaccactcggccacgctcaccacccccgatttcgaccaggcccgc
gccgaagccgcggtgcgtgagttgctgatcgcggtgggtgaggatccggaccgggaaggt
ctgcgggacacgcctgcccgggtggcgcggtcctaccgggagatcttcgccggcctctac
accgatccggacgaggtcctcacgaccatgttcgatgagcagcacgacgagatggtgctg
gtcaaggacatcccgatgtactcgacctgtgagcatcacctggtgtcgttccacggggtg
gcccacgtcggctacatccccggggtcgacggccgggtcaccgggctgtcgaaactggcg
cgcgtggtcgacctgtacgccaagaggccgcaggtgcaggagcggctcaccgcgcagatc
gcggacgcgttgatgcgtaagctcgatccgcgtggcgccatcgtggtgatcgaggccgag
cacctgtgcatggcgatgcgcggcatccgcaagcccggggcggtgacgacgacctccgcg
gtgcgcggacagttcaagaccgacaaggcgtcccgcgccgaagccctggacctgatcctg
cggaagtga

DBGET integrated database retrieval system