KEGG   Mycobacterium gilvum Spyr1: Mspyr1_48510Help
Entry
Mspyr1_48510      CDS       T01376                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Mspyr1_48510
Enzymes [BR:msp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Mspyr1_48510
Exosome [BR:msp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mspyr1_48510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5039481..5040998)
Genome map
AA seq 505 aa AA seqDB search
MADFVAAIDQGTTSTRCMIFGHDGAEVGRHQLEHEQILPKAGWVEHNPVEIWERTGSVLA
TALNATKLATTDLAALGITNQRETSLVWNRHTGRPYYNAIVWQDTRTDRIASALDRDGRG
DVIRRKAGLPPATYFSGGKLQWLLENVDGLRADAANGDALFGTTDTWVLWNLTGGHRGGV
HVTDVTNASRTMLMNLETLDWDDELLGFFDIPRQMLPEIRPSSSPQPYGVTVETGPADGE
IPITGILGDQQAAMVGQVCLDVGEAKNTYGTGNFLLLNTGEKIVRSDNGLLTTVCYQFGD
SKPVYALEGSIAVTGSAVQWLRDQLGIISGASQSESLARQVDDNGGVYFVPAFSGLFAPY
WRSDARGAIVGLSRFNTNAHVARATLEAICYQSRDVVDAMAADSGVPLEVLKVDGGITAN
DLCMQIQADVLGVDVVKPVVAETTALGAAYAAGLAVGFWEGADDLRANWQEGRRWSPQWS
DEQRAEGYAGWQKAVHRTLDWVDVE
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggccgacttcgtcgctgcaatcgaccagggcaccaccagcacgcggtgcatgatcttc
ggccacgacggcgccgaagtgggccgtcaccagctcgaacacgagcagatcctgccgaag
gcgggctgggtggagcacaacccggtggagatctgggaacgcaccggatccgtcctggcc
accgcactgaacgcgacgaagctcgcgacgacggacctcgccgcgctcgggatcaccaac
cagcgcgagacctcgctggtgtggaaccgccacaccggcaggccctactacaacgcgatc
gtctggcaggacacccgcaccgaccggatcgcctccgccctcgaccgcgacggccgcgga
gacgtgatccggcgcaaggccggcctgccgcctgccacctacttctccgggggaaagctg
cagtggctgctggagaacgtcgacggtctgcgcgccgacgccgccaacggcgacgcgctg
ttcggcaccaccgacacctgggtgctgtggaacctcaccggcgggcaccgcggaggcgtg
cacgtcaccgacgtcaccaacgccagccgcacgatgttgatgaacctggaaaccctcgac
tgggacgacgagctgctgggtttcttcgacatcccccgtcagatgctgcccgagatccgg
ccctcgtcgtccccgcagccctacggggtcaccgtcgagacaggccccgccgacggcgag
atcccgatcaccggaatcctcggcgaccagcaggcggcgatggtggggcaggtctgcctc
gacgtcggtgaggccaagaacacctacggcacaggcaatttcctgctgctgaacaccggt
gagaagatcgtgcgctccgacaacgggctgctgaccaccgtgtgttaccagttcggggac
tccaaacccgtttacgcccttgagggttcgatcgccgtcaccgggtcggcggtgcagtgg
ctgcgcgatcaactcgggatcatcagcggggcctcgcagagcgagtcgctggcgcgccag
gtcgacgacaacggcggcgtgtacttcgtgcccgcgttttccggactgttcgcaccgtac
tggcgctccgacgcccgcggcgcgatcgtgggtctgtcccggttcaacaccaacgcccac
gtggcccgcgcgacgctcgaggcgatctgttatcagagtcgcgacgtcgtcgacgcgatg
gccgccgattccggtgtgccccttgaggtcctgaaggtcgacggcggcatcaccgccaac
gacctgtgtatgcagatccaggccgacgtgctcggcgtcgacgtcgtcaagccggtcgtc
gccgagacgacggcgctgggcgcggcctacgcggcagggttggcggtcggattctgggag
ggcgccgacgatctgcgcgcgaactggcaggagggcaggcggtggtcaccgcagtggtcc
gacgagcagcgcgccgagggttacgcgggctggcagaaggccgtgcaccgcacgctggac
tgggtcgacgtcgagtga

DBGET integrated database retrieval system