KEGG   Mycobacterium gilvum Spyr1: Mspyr1_48510Help
Entry
Mspyr1_48510      CDS       T01376                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:msp00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5039481..5040998)
Genome map
AA seq 505 aa AA seqDB search
MADFVAAIDQGTTSTRCMIFGHDGAEVGRHQLEHEQILPKAGWVEHNPVEIWERTGSVLA
TALNATKLATTDLAALGITNQRETSLVWNRHTGRPYYNAIVWQDTRTDRIASALDRDGRG
DVIRRKAGLPPATYFSGGKLQWLLENVDGLRADAANGDALFGTTDTWVLWNLTGGHRGGV
HVTDVTNASRTMLMNLETLDWDDELLGFFDIPRQMLPEIRPSSSPQPYGVTVETGPADGE
IPITGILGDQQAAMVGQVCLDVGEAKNTYGTGNFLLLNTGEKIVRSDNGLLTTVCYQFGD
SKPVYALEGSIAVTGSAVQWLRDQLGIISGASQSESLARQVDDNGGVYFVPAFSGLFAPY
WRSDARGAIVGLSRFNTNAHVARATLEAICYQSRDVVDAMAADSGVPLEVLKVDGGITAN
DLCMQIQADVLGVDVVKPVVAETTALGAAYAAGLAVGFWEGADDLRANWQEGRRWSPQWS
DEQRAEGYAGWQKAVHRTLDWVDVE
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggccgacttcgtcgctgcaatcgaccagggcaccaccagcacgcggtgcatgatcttc
ggccacgacggcgccgaagtgggccgtcaccagctcgaacacgagcagatcctgccgaag
gcgggctgggtggagcacaacccggtggagatctgggaacgcaccggatccgtcctggcc
accgcactgaacgcgacgaagctcgcgacgacggacctcgccgcgctcgggatcaccaac
cagcgcgagacctcgctggtgtggaaccgccacaccggcaggccctactacaacgcgatc
gtctggcaggacacccgcaccgaccggatcgcctccgccctcgaccgcgacggccgcgga
gacgtgatccggcgcaaggccggcctgccgcctgccacctacttctccgggggaaagctg
cagtggctgctggagaacgtcgacggtctgcgcgccgacgccgccaacggcgacgcgctg
ttcggcaccaccgacacctgggtgctgtggaacctcaccggcgggcaccgcggaggcgtg
cacgtcaccgacgtcaccaacgccagccgcacgatgttgatgaacctggaaaccctcgac
tgggacgacgagctgctgggtttcttcgacatcccccgtcagatgctgcccgagatccgg
ccctcgtcgtccccgcagccctacggggtcaccgtcgagacaggccccgccgacggcgag
atcccgatcaccggaatcctcggcgaccagcaggcggcgatggtggggcaggtctgcctc
gacgtcggtgaggccaagaacacctacggcacaggcaatttcctgctgctgaacaccggt
gagaagatcgtgcgctccgacaacgggctgctgaccaccgtgtgttaccagttcggggac
tccaaacccgtttacgcccttgagggttcgatcgccgtcaccgggtcggcggtgcagtgg
ctgcgcgatcaactcgggatcatcagcggggcctcgcagagcgagtcgctggcgcgccag
gtcgacgacaacggcggcgtgtacttcgtgcccgcgttttccggactgttcgcaccgtac
tggcgctccgacgcccgcggcgcgatcgtgggtctgtcccggttcaacaccaacgcccac
gtggcccgcgcgacgctcgaggcgatctgttatcagagtcgcgacgtcgtcgacgcgatg
gccgccgattccggtgtgccccttgaggtcctgaaggtcgacggcggcatcaccgccaac
gacctgtgtatgcagatccaggccgacgtgctcggcgtcgacgtcgtcaagccggtcgtc
gccgagacgacggcgctgggcgcggcctacgcggcagggttggcggtcggattctgggag
ggcgccgacgatctgcgcgcgaactggcaggagggcaggcggtggtcaccgcagtggtcc
gacgagcagcgcgccgagggttacgcgggctggcagaaggccgtgcaccgcacgctggac
tgggtcgacgtcgagtga

DBGET integrated database retrieval system