KEGG   Mycobacterium gilvum Spyr1: Mspyr1_48930Help
Entry
Mspyr1_48930      CDS       T01376                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:msp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Mspyr1_48930
DNA repair and recombination proteins [BR:msp03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Mspyr1_48930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5080876..5081487)
Genome map
AA seq 203 aa AA seqDB search
MFEGPVQDLIDELGKLPGIGPKSAQRIAFHLLSVEPPDIDRLTAVLNRVRDGVTFCSVCG
NVSDEERCRICGDARRDASLICVVEEPKDVQAVERTREFRGRYHVLGGALDPLSGIGPDQ
LRIRELLNRIGERVDGVDVAEVIIATDPNTEGEATATYLVRMLRDIPGLSVTRIASGLPM
GGDLEFADELTLGRALAGRRAMA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagggacctgttcaggatctgatcgacgagctcggcaagctgccgggcatcggg
ccgaagagtgcccagcgcatcgcgttccatctgttgtcggtcgaacctcccgacatcgac
cggctcaccgcggtgctcaaccgggtccgcgacggtgtcacgttctgctcggtgtgcggc
aacgtcagcgacgaggagcggtgccgaatctgcggggatgcgcgccgggacgcgtcgttg
atctgtgtggtcgaagaacccaaggacgtccaggccgtcgagcgcacgcgtgagttccgc
ggccgctaccacgtcctcggcggcgcactcgacccgttgtccgggatcggacccgaccag
ctgcgcatccgcgaactgctgaaccggatcggcgagcgcgtcgacggcgtcgacgtcgcc
gaggtcatcatcgccaccgaccccaacaccgagggcgaggccacggcgacgtacctggtg
cggatgctgcgcgacatcccggggctttccgtgacgcgcatcgcgtcgggcctgccgatg
ggcggagacctggagttcgccgacgagctcacgctggggcgggcgctggcgggccgccgc
gcgatggcgtaa

DBGET integrated database retrieval system