KEGG   Mycobacterium gilvum Spyr1: Mspyr1_50790Help
Entry
Mspyr1_50790      CDS       T01376                                 

Definition
nucleoside-diphosphate-sugar epimerase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
msp  Mycobacterium gilvum Spyr1
Brite
Enzymes [BR:msp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     Mspyr1_50790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5268577..5269608)
Genome map
AA seq 343 aa AA seqDB search
MSAPVLVIGANGYLGSHVTRKLVAAGNDVRVMVRDGANTVGIDDLAVTRYVGDIWNSDVL
REAMTGCEVVYYCVVDTRGWLRDPAPLFRTNVEGTRNVLDVAVEPGIAATLRKFVFTSSY
VTVGRTRGRVATEADVISDPADLKSLTPYVRSRVQAENLVMEYARERGLPAVAMCVSTTY
GAGDWGRTPHGAIIAGSAFGKLPFVMGGIELEAVGIDDAAQAMLLAAQKGRAGERYLISE
KMISNADVVRIAAEAAGVPAPTKKIPLVLSYAMAALGSAKSRLKGTDERMSLGSLRLMRA
EAPVDCSKARRELGWQPRPVEESIREAAKFWVGLKAAKRQRTA
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcgccggtcctcgtcatcggggccaacggctacctcggcagccacgtcacccgg
aaactcgtggccgccggcaacgacgtccgggtgatggtgcgcgacggcgccaacaccgtc
ggcatcgacgacctggccgtcacccgctacgtcggcgacatctggaactccgacgtgttg
cgcgaggccatgacgggctgcgaggtcgtctactactgcgtcgtggacacccgcggctgg
cttcgcgacccggcgccgctgttccgcaccaacgtcgagggcacccgcaacgtcctggac
gtcgcggtggagcccgggatcgccgcgacgctgcggaagttcgtcttcaccagcagctat
gtgaccgtggggcgcacgaggggacgtgtcgccaccgaggccgacgtgatctccgaccct
gccgatctgaagagcctgaccccctatgtccgttcgcgtgtccaggccgagaacctggtg
atggagtacgcgcgcgaacgcgggctgcccgcggtcgcgatgtgcgtgtccaccacgtac
ggcgccggtgactggggccgcaccccgcacggcgcgatcatcgcaggctccgcgttcggc
aagctgccgttcgtgatgggcggcatcgaactcgaagcggtcgggatcgacgacgcggcg
caggccatgctgctggccgcgcagaagggtcgcgcgggtgagcggtacctgatctcggag
aagatgatctccaacgccgacgtcgtccggatcgccgccgaagccgccggagtgccggcg
ccgacgaagaagatcccgctggtgctgtcctacgcgatggcggcgctgggcagcgcgaag
tcccggctgaagggcaccgacgagcggatgtcgctgggatcgctgcggctgatgcgggcc
gaggctccggtcgactgcagcaaggcacgccgtgaactgggctggcagccccggcccgtg
gaggagtcgatccgtgaagccgcgaaattctgggtcggtctcaaagccgccaagcggcaa
cgcaccgcctga

DBGET integrated database retrieval system