KEGG   Mycobacterium gilvum Spyr1: Mspyr1_51870Help
Entry
Mspyr1_51870      CDS       T01376                                 

Definition
cellobiohydrolase A (1,4-beta-cellobiosidase A)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mspyr1_51870
Enzymes [BR:msp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Mspyr1_51870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5369590..5370582)
Genome map
AA seq 330 aa AA seqDB search
MSSAAHAAARWIAPFLTVAAVAGFAVAAQPAPRGTAPEVRLVSDANPLVGRPFYVNPNSK
GTRAAQSNPDPLLAAVVNTPTAYWMDHISTPAVDAKYIATAQAAGTTPVLALYGIPNRDC
GSYAAGGFGSAGSYRAWIDGVAGAIGGGPAAVILEPDALAMIDCLSPGQQQERLELIGYA
VDTLTRNPATAVYVDAGHSRWVPADVMAGRLNQVGIAKARGFSLNTANFFTTEESVGYGG
AISGMTGGKPFVIDTSRNGAGPVEGDDLYWCNPSGRALGVRPTTDTGNPMVDAFLWVKRP
GESDGACRGAPSAGTFIAQYAIDLARNAGW
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccgctgcccacgcagccgcacgatggatcgcccccttcctgacggttgccgcc
gtcgccggtttcgccgtcgcagcgcaacccgcgcctcgcggcaccgcaccggaggtccgg
ctggtcagcgacgcgaacccgctggtcgggcggccgttttacgtcaacccgaactccaag
gggacgcgcgccgcgcagagcaacccggacccgctgctggccgcggtggtcaacacgccc
accgcgtactggatggaccacatctccaccccggcggtcgacgcgaagtacatcgcgacc
gctcaggccgccggcaccaccccggtgctggccctctacgggatcccgaaccgcgactgc
ggcagctacgccgccggcgggttcggatcggccgggtcgtaccgggcgtggatcgacgga
gtcgccggcgccatcggcggcgggcccgccgcggtgatcctcgaaccggacgcgctcgcg
atgatcgactgcctgtcacccggccagcagcaggagcgcctggagctcatcggctacgcg
gtcgacacgctgacccgcaacccggcgaccgcggtgtacgtcgacgccgggcattcgcgc
tgggtgcccgccgacgtgatggcgggccggctcaaccaggtcgggatcgcgaaggcgcgc
ggcttcagcctcaacaccgcgaacttcttcaccaccgaggagtcggtgggctacggcggc
gcgatctcggggatgaccggcggcaagccgttcgtcatcgacacgtcccgcaacggcgcc
ggaccggtcgagggcgacgacctctactggtgcaatccgagcggccgcgccctcggcgtg
cgacccaccaccgacacgggcaacccgatggtcgacgcgttcctctgggtcaagcggccc
ggagaatccgacggcgcgtgccgcggtgcgcccagtgcgggcaccttcatcgcccagtac
gcgatcgacctggcccgcaacgccggttggtga

DBGET integrated database retrieval system