KEGG   Mycobacterium gilvum Spyr1: Mspyr1_51870Help
Entry
Mspyr1_51870      CDS       T01376                                 

Definition
cellobiohydrolase A (1,4-beta-cellobiosidase A)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:msp00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5369590..5370582)
Genome map
AA seq 330 aa AA seqDB search
MSSAAHAAARWIAPFLTVAAVAGFAVAAQPAPRGTAPEVRLVSDANPLVGRPFYVNPNSK
GTRAAQSNPDPLLAAVVNTPTAYWMDHISTPAVDAKYIATAQAAGTTPVLALYGIPNRDC
GSYAAGGFGSAGSYRAWIDGVAGAIGGGPAAVILEPDALAMIDCLSPGQQQERLELIGYA
VDTLTRNPATAVYVDAGHSRWVPADVMAGRLNQVGIAKARGFSLNTANFFTTEESVGYGG
AISGMTGGKPFVIDTSRNGAGPVEGDDLYWCNPSGRALGVRPTTDTGNPMVDAFLWVKRP
GESDGACRGAPSAGTFIAQYAIDLARNAGW
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccgctgcccacgcagccgcacgatggatcgcccccttcctgacggttgccgcc
gtcgccggtttcgccgtcgcagcgcaacccgcgcctcgcggcaccgcaccggaggtccgg
ctggtcagcgacgcgaacccgctggtcgggcggccgttttacgtcaacccgaactccaag
gggacgcgcgccgcgcagagcaacccggacccgctgctggccgcggtggtcaacacgccc
accgcgtactggatggaccacatctccaccccggcggtcgacgcgaagtacatcgcgacc
gctcaggccgccggcaccaccccggtgctggccctctacgggatcccgaaccgcgactgc
ggcagctacgccgccggcgggttcggatcggccgggtcgtaccgggcgtggatcgacgga
gtcgccggcgccatcggcggcgggcccgccgcggtgatcctcgaaccggacgcgctcgcg
atgatcgactgcctgtcacccggccagcagcaggagcgcctggagctcatcggctacgcg
gtcgacacgctgacccgcaacccggcgaccgcggtgtacgtcgacgccgggcattcgcgc
tgggtgcccgccgacgtgatggcgggccggctcaaccaggtcgggatcgcgaaggcgcgc
ggcttcagcctcaacaccgcgaacttcttcaccaccgaggagtcggtgggctacggcggc
gcgatctcggggatgaccggcggcaagccgttcgtcatcgacacgtcccgcaacggcgcc
ggaccggtcgagggcgacgacctctactggtgcaatccgagcggccgcgccctcggcgtg
cgacccaccaccgacacgggcaacccgatggtcgacgcgttcctctgggtcaagcggccc
ggagaatccgacggcgcgtgccgcggtgcgcccagtgcgggcaccttcatcgcccagtac
gcgatcgacctggcccgcaacgccggttggtga

DBGET integrated database retrieval system