KEGG   Mycobacterium gilvum Spyr1: Mspyr1_54760Help
Entry
Mspyr1_54760      CDS       T01376                                 

Definition
phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
msp  Mycobacterium gilvum Spyr1
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Mspyr1_54760
Enzymes [BR:msp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Mspyr1_54760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pMSPYR101:125649..128063
Genome map
AA seq 804 aa AA seqDB search
MSVTTPTSDLSTARPGASGPLSPDDLRLLDAYWRAANFLSVGQIYLLDNPLLREPLQLDH
VKPRLLGHWGTTPGLNLIYAHLNRVIRGRELNAMYVIGPGHGGPGLVANAYLEGTYSEVY
PGISRDADGLRRLFRQFSFPGGIPSHVAPETPGSIHEGGELGYALAHAYGAAFDNPDLLV
ACVVGDGEAETGPLAASWQSNKFLDPVHDGAVLPILHLNGYKIANPTVLARIPDDELIDL
LQGYGHRPYVVSGHDPAQVHQDLAAAMDDAVTEIARIQQAAREDGDTQRPRWPLIVLATP
KGWTGPKEVDGLPTEGTWRSHQVPLANLADNPEHLRQLEEWLRSYRPEELFDEAGALIAE
LAALPPTGCARMSASPHANGGQLLKPLRLPDFGDYAVAVPAPATALHEATRVLGAFLRDV
IRDNPHNFRLMGPDETASNRLGAVFEQTDRVWQGESLPTDEHLARAGRVMEVLSEHLCQG
WLEGYLLTGRHGLFSCYEAFIHIVDSMVNQHAKWLKVTNDIPWRAPIASLNYLLTSHVWR
QDHNGFSHQDPGFIDHVVNKKAAIVRVYLPPDANTLLSVADHCLRSRQYINLIVAGKQPA
LSYLDIEEAVAHCTRGLGIWEWAGNDGGDGADGLPDVVLACAGDVPTLETLAAAALLRQH
LPALRVRVVNVVDLMRLQPDTEHPHGLPDAQFDALFTPDRPVIFAYHGYPWLIHRLTYRR
ANHVNIHVRGYKEEGTTTTPFDLVMLNDLDRFHLVIDVIDRVPGLGAAAAALRQRMVDAR
LRARAYTRAHGEDDPAISGWTWPS
NT seq 2415 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcaccaccccgacttccgacctcagcaccgcccggccaggcgcatccggcccg
ctgtcacccgacgatctgcgtctgttggatgcgtactggcgggcggccaatttcttgtcg
gtcgggcagatctatctgctggataatccgctgctgcgggagcctctgcagctcgatcat
gtcaagccgcggctgctcgggcattgggggaccacgcccggactcaacctgatctacgcc
cacctcaaccgggtcatccgggggcgcgagctgaacgcgatgtatgtgatcggtccgggc
cacggtggcccgggactcgtagccaacgcctacctggagggcacctacagcgaggtctac
cccggcatcagccgcgatgccgacggcctgcgccgactgttccggcagttctccttcccc
ggcggcatccccagccacgtcgccccggaaaccccgggctccatccatgagggcggcgag
ctgggctatgcgttggcgcacgcctacggtgccgcgttcgacaaccccgacctgctggtg
gcctgcgtcgtcggcgacggcgaggctgagaccgggccgctggcggcgagttggcagtcc
aacaagttcctcgacccggtccacgatggcgccgtcctgccgatcctgcacctcaacggc
tacaagatcgccaacccgacggtcctggcacgcatccccgacgacgagctgatcgacctg
ctgcagggctacggacaccggccgtatgtggtgtcaggccacgacccggcacaggttcac
caggacctcgccgcggcgatggacgacgcggtcaccgagatcgccaggattcagcaagcc
gctcgagaagatggagacacgcagcggccgcgctggccgctgatcgtcttagcgaccccc
aagggatggaccggtccgaaggaggtcgacggcctccccacggaggggacctggcgctcg
catcaggtgccgctggccaatctggccgacaatcccgagcatctgcgccagctcgaggag
tggctgcgcagctaccggcccgaggaattgttcgacgaggccggcgcgctgatcgcggag
ctggcggcgctgccgccgaccgggtgtgcgcggatgagcgccagcccgcacgccaacggc
gggcagctgctaaagccgctgcggctgcccgacttcggcgactacgccgtcgcggtcccc
gcgccggccacggcgctgcacgaggcgacgcgggtgctcggggcgttcctgcgtgacgtc
atccgggacaacccccacaatttccggctgatgggccccgacgagaccgccagcaaccgg
ctcggcgcggtgtttgagcaaaccgaccgggtgtggcaaggcgaatcgctgcccaccgat
gagcacctcgcgcgggcgggacgtgtcatggaggtgctctccgagcacctgtgccagggc
tggctggagggctatctactcaccggccggcacggcctgttctcctgctacgaggcgttc
atccacatcgtggattcgatggtcaaccaacacgcgaaatggctcaaagtcaccaacgac
ataccgtggcgggcgccgatcgcgtcgctgaactacctgctgacctcgcacgtgtggcgc
caggaccacaacgggttctcccaccaggaccccgggttcatcgaccatgtggtgaacaag
aaggcggcgatcgtgcgggtctatctgccgccggacgccaacacgttgctgtcggtggcc
gatcactgtctgcgcagccgccagtacatcaacttgatcgtggccggcaagcagccggcg
ctgtcctatctggacatcgaggaggcggtcgcgcactgcacccgcgggctgggaatctgg
gaatgggccggcaacgacggcggcgacggcgccgacgggctgccggacgtggtgctggcc
tgcgcgggcgacgtcccgaccctggaaacgctcgcggccgcggcgctgctgcgacaacac
ctgcccgccctgcgggtgcgggtcgtcaacgtggtcgatctgatgcggctgcagcccgat
accgaacacccgcacgggctgcccgacgcccagttcgatgcactgttcaccccggaccgg
ccggtcatcttcgcctaccacggctacccgtggctgatccaccggctcacttaccggcgg
gccaaccacgtcaacatccacgtccgcggctataaggaggaaggaaccacgaccactccg
ttcgacctcgtcatgctcaacgacctggaccgcttccacctggtcatcgacgtcatcgac
cgggtaccgggcctgggcgccgccgcggcggcgctgcgccagcggatggttgacgcgcgg
ctgcgcgcccgcgcctacacccgagcccacggcgaggacgaccccgccatcagcggctgg
acctggccctcttag

DBGET integrated database retrieval system