KEGG   Mycoplasma suis Illinois: MSU_0071Help
Entry
MSU_0071          CDS       T01438                                 

Gene name
tim
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mss  Mycoplasma suis Illinois
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mss00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MSU_0071 (tim)
   01230 Biosynthesis of amino acids
    MSU_0071 (tim)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSU_0071 (tim)
   00051 Fructose and mannose metabolism
    MSU_0071 (tim)
   00562 Inositol phosphate metabolism
    MSU_0071 (tim)
Enzymes [BR:mss01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MSU_0071 (tim)
Exosome [BR:mss04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MSU_0071 (tim)
  Exosomal proteins of bladder cancer cells
   MSU_0071 (tim)
  Exosomal proteins of melanoma cells
   MSU_0071 (tim)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
61986..62696
Genome map
AA seq 236 aa AA seqDB search
MARKVIIGNLKMNLLRHELNFYLTELRKKLQNETPKHKFGLSFPYIYLEKTAEEIGGQLQ
IFAQDVHHAEKGAYTSFISAPQLSSIKVYSTLIGHSECREMGQTEEIVSKKVRSALLNGL
EVIYCCGKDPLKEIKNELFFLNSKTVEKISIAFEPISAIGTGEAMPPEVAVKNLKAIREL
AIDMWGESGKKITLLYGGSVNQKNYQSYLSEPAIDGILVGSAALNINSLWEMVMGR
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaaggttattattggaaatctgaaaatgaaccttttgagacatgaacttaat
ttctacttaacagagttaagaaagaaattacaaaatgaaactccaaaacataagtttggt
ttgtcttttccatatatatatctggaaaagactgccgaagaaataggaggacaacttcaa
atatttgctcaagatgtacaccacgcagaaaaaggagcatatacttccttcatttctgcc
cctcaattgagttctattaaggtttactcaaccttaataggacattctgaatgtagagaa
atgggccaaacagaagaaattgtttctaagaaggttagatcagctcttctaaatggatta
gaagttatttattgttgcgggaaagatccactgaaagaaataaagaatgaattattcttt
ttgaattcaaagactgtagaaaaaatttctatagcctttgaacctattagtgctataggt
actggagaagcaatgcccccagaagtagcagtaaaaaacttaaaagctataagagaattg
gctatagatatgtggggagaaagtggtaaaaaaataactttactatatggaggatcagta
aatcaaaaaaattatcaaagttatctttcagaacctgctatagatggaatactagtaggt
tctgcagccttaaatatcaattccctttgagaaatggttatgggaagatag

DBGET integrated database retrieval system