KEGG   Mycoplasma suis Illinois: MSU_0071Help
Entry
MSU_0071          CDS       T01438                                 

Gene name
tim
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mss  Mycoplasma suis Illinois
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mss00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MSU_0071 (tim)
   01230 Biosynthesis of amino acids
    MSU_0071 (tim)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSU_0071 (tim)
   00051 Fructose and mannose metabolism
    MSU_0071 (tim)
   00562 Inositol phosphate metabolism
    MSU_0071 (tim)
Enzymes [BR:mss01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MSU_0071 (tim)
Exosome [BR:mss04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MSU_0071 (tim)
  Exosomal proteins of bladder cancer cells
   MSU_0071 (tim)
  Exosomal proteins of melanoma cells
   MSU_0071 (tim)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
61986..62696
Genome map
AA seq 236 aa AA seqDB search
MARKVIIGNLKMNLLRHELNFYLTELRKKLQNETPKHKFGLSFPYIYLEKTAEEIGGQLQ
IFAQDVHHAEKGAYTSFISAPQLSSIKVYSTLIGHSECREMGQTEEIVSKKVRSALLNGL
EVIYCCGKDPLKEIKNELFFLNSKTVEKISIAFEPISAIGTGEAMPPEVAVKNLKAIREL
AIDMWGESGKKITLLYGGSVNQKNYQSYLSEPAIDGILVGSAALNINSLWEMVMGR
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaaggttattattggaaatctgaaaatgaaccttttgagacatgaacttaat
ttctacttaacagagttaagaaagaaattacaaaatgaaactccaaaacataagtttggt
ttgtcttttccatatatatatctggaaaagactgccgaagaaataggaggacaacttcaa
atatttgctcaagatgtacaccacgcagaaaaaggagcatatacttccttcatttctgcc
cctcaattgagttctattaaggtttactcaaccttaataggacattctgaatgtagagaa
atgggccaaacagaagaaattgtttctaagaaggttagatcagctcttctaaatggatta
gaagttatttattgttgcgggaaagatccactgaaagaaataaagaatgaattattcttt
ttgaattcaaagactgtagaaaaaatttctatagcctttgaacctattagtgctataggt
actggagaagcaatgcccccagaagtagcagtaaaaaacttaaaagctataagagaattg
gctatagatatgtggggagaaagtggtaaaaaaataactttactatatggaggatcagta
aatcaaaaaaattatcaaagttatctttcagaacctgctatagatggaatactagtaggt
tctgcagccttaaatatcaattccctttgagaaatggttatgggaagatag

DBGET integrated database retrieval system