KEGG   Mycoplasma suis Illinois: MSU_0071Help
Entry
MSU_0071          CDS       T01438                                 

Gene name
tim
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mss  Mycoplasma suis Illinois
Pathway
mss00010  Glycolysis / Gluconeogenesis
mss00051  Fructose and mannose metabolism
mss01100  Metabolic pathways
mss01110  Biosynthesis of secondary metabolites
mss01120  Microbial metabolism in diverse environments
mss01130  Biosynthesis of antibiotics
mss01200  Carbon metabolism
mss01230  Biosynthesis of amino acids
Module
mss_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mss00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSU_0071 (tim)
   00051 Fructose and mannose metabolism
    MSU_0071 (tim)
   00562 Inositol phosphate metabolism
    MSU_0071 (tim)
Enzymes [BR:mss01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MSU_0071 (tim)
Exosome [BR:mss04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MSU_0071 (tim)
  Exosomal proteins of bladder cancer cells
   MSU_0071 (tim)
  Exosomal proteins of melanoma cells
   MSU_0071 (tim)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADX97615
UniProt: F0QQ45
Position
61986..62696
Genome map
AA seq 236 aa AA seqDB search
MARKVIIGNLKMNLLRHELNFYLTELRKKLQNETPKHKFGLSFPYIYLEKTAEEIGGQLQ
IFAQDVHHAEKGAYTSFISAPQLSSIKVYSTLIGHSECREMGQTEEIVSKKVRSALLNGL
EVIYCCGKDPLKEIKNELFFLNSKTVEKISIAFEPISAIGTGEAMPPEVAVKNLKAIREL
AIDMWGESGKKITLLYGGSVNQKNYQSYLSEPAIDGILVGSAALNINSLWEMVMGR
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaaggttattattggaaatctgaaaatgaaccttttgagacatgaacttaat
ttctacttaacagagttaagaaagaaattacaaaatgaaactccaaaacataagtttggt
ttgtcttttccatatatatatctggaaaagactgccgaagaaataggaggacaacttcaa
atatttgctcaagatgtacaccacgcagaaaaaggagcatatacttccttcatttctgcc
cctcaattgagttctattaaggtttactcaaccttaataggacattctgaatgtagagaa
atgggccaaacagaagaaattgtttctaagaaggttagatcagctcttctaaatggatta
gaagttatttattgttgcgggaaagatccactgaaagaaataaagaatgaattattcttt
ttgaattcaaagactgtagaaaaaatttctatagcctttgaacctattagtgctataggt
actggagaagcaatgcccccagaagtagcagtaaaaaacttaaaagctataagagaattg
gctatagatatgtggggagaaagtggtaaaaaaataactttactatatggaggatcagta
aatcaaaaaaattatcaaagttatctttcagaacctgctatagatggaatactagtaggt
tctgcagccttaaatatcaattccctttgagaaatggttatgggaagatag

DBGET integrated database retrieval system