KEGG   Mycoplasma suis Illinois: MSU_0390Help
Entry
MSU_0390          CDS       T01438                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase (EC:6.1.1.24)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
mss  Mycoplasma suis Illinois
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mss00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    MSU_0390 (gltX)
Enzymes [BR:mss01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     MSU_0390 (gltX)
Amino acid related enzymes [BR:mss01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   MSU_0390 (gltX)
Transfer RNA biogenesis [BR:mss03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    MSU_0390 (gltX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(327252..328703)
Genome map
AA seq 483 aa AA seqDB search
MRRVRTRFAPSPTGEFHIGGLRTALVNFLYAKQNHGDFVLRIEDTDQTRNQQEQVQKILD
YLESLLLIPDESFVCPGLYGPYLQTQKIEIYKKRIQELFEKDRVYRCFCTEEELEKEREE
NPYLYSGKCKHLSKEEIDEKLANGIPYCYRLKLDQSKEYVWEDYVRGKMTFPASSMGEII
LMRSNGLPTYNFAVVVDDYEMKISDIFRGEEHLSNTPYQIALYEAFGWEEFIPNFGHLSL
IMSAETGKKISKRDVNAQKYLVSYFLEKGYHPEALLNYLLLLGWTCGEREFFNLKESISN
FSISGLSGSPSICDFKKLEWMSFSYLSKMDVFQYLNFVLPFFKGNIEGFQLSEEMKKEFA
IRFRSRVKYAYSLVEISEEFYSEKYLNEEFFEKLKEYENIEEFIEKTLSFFTSNQVESWT
EAEARLLLKKLFNELGTPKPDICHKLRFLLTGDPEGLPMYSTILLLGQDNICSRLRDVSK
KLK
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
attagaagagtaagaacaagatttgctccctcccctacaggggaatttcatataggtggt
cttagaactgcacttgttaatttcttatatgctaagcaaaatcacggagattttgtctta
agaatagaagatactgatcaaactagaaatcaacaagaacaagttcaaaagattctagat
tacctagaatctttacttcttattccggatgaatcttttgtttgtccgggactttatggt
ccttacttacaaactcaaaaaattgagatttataaaaagagaatacaagagttatttgaa
aaagatagagtttacagatgtttttgtacagaagaagagttagaaaaagaaagggaagaa
aatccctatctttactctgggaaatgtaaacatctttctaaagaagagatagatgaaaaa
ctagctaatggtattccatattgctatagacttaagctggatcagtctaaagaatatgta
tgagaagactatgttagaggaaaaatgacttttccagcttcttctatgggggaaataata
cttatgagaagtaatggacttccgacctacaactttgcagtagttgtagatgattatgaa
atgaaaatatcagatattttcaggggagaagaacatctctcaaatactccttaccaaata
gctttatatgaagcttttggatgagaagagtttattcctaattttggacatctctcccta
ataatgtcggcagagacaggaaaaaaaatctctaagagagatgtcaatgcacaaaaatat
ctagtaagttacttcctagaaaagggatatcatccagaagctcttctaaactatttactt
cttttaggttgaacttgtggtgaaagagaattcttcaacctaaaagaaagtatttctaac
ttttcaatatcgggtttaagtggatctccttctatttgtgatttcaagaagttggaatga
atgagcttttcttacctaagtaagatggacgtttttcaatatttgaattttgtattgccc
ttcttcaagggcaatatagagggatttcaattatccgaagaaatgaaaaaagaatttgca
attagattcagatctagagttaagtatgcttattctctagttgaaatttccgaagaattc
tatagtgagaaatacttaaatgaggaattcttcgaaaaactaaaagaatatgaaaatatt
gaagaatttattgaaaaaactttgagttttttcacttctaatcaagtagagtcttgaact
gaggcggaagcaagactattgctgaaaaaattatttaatgaattgggaactccaaaacct
gatatttgtcataaattaagattccttttaactggcgatccagaaggacttccaatgtat
tcaactattcttttgttggggcaagacaatatctgctctagattaagagatgtttcgaaa
aaactaaagtag

DBGET integrated database retrieval system