KEGG   Mycoplasma suis Illinois: MSU_0702Help
Entry
MSU_0702          CDS       T01438                                 

Gene name
pfk
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mss  Mycoplasma suis Illinois
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:mss00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MSU_0702 (pfk)
   01230 Biosynthesis of amino acids
    MSU_0702 (pfk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSU_0702 (pfk)
   00030 Pentose phosphate pathway
    MSU_0702 (pfk)
   00051 Fructose and mannose metabolism
    MSU_0702 (pfk)
   00052 Galactose metabolism
    MSU_0702 (pfk)
  Energy metabolism
   00680 Methane metabolism
    MSU_0702 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    MSU_0702 (pfk)
Enzymes [BR:mss01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MSU_0702 (pfk)
Protein phosphatases and associated proteins [BR:mss01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MSU_0702 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(575623..576606)
Genome map
AA seq 327 aa AA seqDB search
MRKVAILTSGGDAPGMNSSLYSFSKLATQKGYEVLYVKNGYQGFINGEFTSIDLNQLKKE
VYSPGTVIGSSRSPEFKSSPEARAKGVQQLKDKGVEALVVLGGNGSYEGAELISKLGLPV
ILLPATIDNDVTSSEYTIGFFSALEEISQSIRKIWYTAESHSQLTFVEVMGRDCSDLAVL
ASSASPLVDYVITSKNVPSFEELKSRISSLKSSGRKGIVILVVEKILGKSVLPSMGELTS
KLESELGFTVRGCVLGHTQRGAIPTSWELFVSSQFGRKAFEAFDSKEFDIAIGFNGSSFY
KTSIDKLDSSSKGDRLSLIEEKNSLVS
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
ttgagaaaggtagctattttaacttcaggaggtgatgcccctggaatgaatagctcccta
tactcattcagtaagctagctactcaaaaaggttacgaagttctatatgttaagaatgga
tatcaaggattcattaatggtgaattcacatctatcgatctaaatcaattaaagaaagaa
gtttattctcctggaacagttattggttcaagcagatctcctgaatttaagtcttctcct
gaagcgagagctaaaggagttcaacaactaaaagataagggagtggaagcactagtagtt
ttgggaggtaatggatcatatgaaggagcagaattaatttctaagctgggacttccagtt
attttgcttccagcaacaattgataatgatgttacttctagtgaatacactataggtttc
ttctctgcactagaagaaatttcccaatcaattagaaagatttgatatacagctgaatct
cattcccaattaacttttgtagaagttatgggaagagattgttctgatttagctgtacta
gcttctagtgcttctccactagttgactatgttattacttcaaagaatgttccatccttt
gaagaacttaagtcaagaatttcttctcttaagagttcaggaagaaaaggtattgttatc
ctagtagtggaaaaaattcttggtaagtcagttctaccttctatgggagaactgacatca
aaactagaaagtgaacttggtttcactgttagaggttgtgtattaggacatacacaacga
ggagctattccaacttcctgagaactatttgtttcttctcaatttggtcgaaaagctttt
gaagctttcgactctaaagaatttgatattgctatagggtttaatggatctagcttttat
aagacttcaattgataagctagatagttcttcaaaaggagatagactatctcttattgaa
gaaaagaatagtttagtttcctag

DBGET integrated database retrieval system