KEGG   Mycoplasma suis Illinois: MSU_0790Help
Entry
MSU_0790          CDS       T01438                                 

Gene name
ruvA
Definition
holliday junction ATP-dependent DNA helicase, RuvA (EC:3.6.4.12)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mss  Mycoplasma suis Illinois
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mss00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MSU_0790 (ruvA)
Enzymes [BR:mss01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     MSU_0790 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
647318..647938
Genome map
AA seq 206 aa AA seqDB search
MYYLKCQIISVHKNYLIAESNGKGYKINFADTYSIKEQEEHLIYVFREFKLDTKNQITSQ
LFGFLSEKEFELFNSLLAIKGIGCKTAQAILTNDWNMMYFLAEREERLKLAELRGFNLKI
ANLFIYSIKNMKSLKNSFNKHSSSSYSDSKECKEKEVISSLIKIGYKFDDIKRALDIIRE
SDTELKNDFNSLINECLKTISQIKYH
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgtactacttaaagtgtcaaattatctcagtgcacaaaaattatttaattgctgaaagt
aatggaaagggttacaaaataaactttgctgatacttattccattaaggagcaagaagag
catttaatttatgtgttccgagaatttaagctagacactaaaaatcaaataacttcccaa
ttatttggttttctttctgaaaaagaatttgaattatttaacagtctattggcgataaaa
ggaataggttgtaaaacagctcaagccatattaactaatgactgaaatatgatgtacttc
ttggcagaacgtgaagaaagactaaaactagctgaactaaggggattcaatctgaaaata
gctaatttatttatctactcaataaaaaatatgaagtcactaaaaaattcttttaataaa
cattcttcatccagttattctgattccaaagaatgtaaagagaaggaagttatttcttct
ctaataaaaattggatacaaatttgatgacataaaaagagctctagacattattagagaa
agcgatactgaattgaagaatgacttcaattcgctaattaatgaatgtttaaaaacaata
tctcaaatcaaatatcactag

DBGET integrated database retrieval system