KEGG   Methanosphaera stadtmanae: Msp_0003Help
Entry
Msp_0003          CDS       T00313                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mst  Methanosphaera stadtmanae
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mst00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mst00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2530..3444)
Genome map
AA seq 304 aa AA seqDB search
MKFSLENIISIRDFKKSDVEYILNLAEEMEPIAKSQKVCHEKDGKLLGVMFYEPSTRTRL
SFETAMKRLGGDVVGFNQKQGTSIQKGEVLYDTAQIVSQYTDAIVLRHDMEGAARFVSNI
VDVPVINAGDGAGQHPTQTMLDLYTIKRTLGELKNLKIALVGDLKYGRTVHSLVYALAMF
NVEIVFISPSELEMPPEILRDLEKLNCKFSIKNSLIENIDDVDVIYMTRIQKERFPDPKE
YLKVKGQYTLTSKNLKDSNTIIMHPLPRVDEIDFNVDNLSNAMYFKQAFYGVPVRMALLD
SIIK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttagtttagaaaatataatatctataagagactttaaaaagagtgatgttgaa
tatatattgaatcttgctgaggaaatggaacctattgctaaatctcagaaggtttgtcat
gaaaaggatggtaaattattaggtgttatgttttatgaaccatcaactcgtacacgttta
tcatttgaaactgctatgaaacgtttaggtggagatgttgttggatttaatcaaaaacaa
ggtacaagtattcaaaaaggtgaagtattatatgatactgctcaaatagtttctcaatat
actgatgctattgttttaagacatgatatggaaggagctgctagatttgtatcaaatatt
gttgatgttccagtgataaatgcaggtgatggtgcaggacaacatccaacacaaactatg
ctagatttatatactattaaaagaacattaggtgaattaaaaaacttaaaaattgctctt
gttggggatttaaagtatggacgtacagttcatagtttagtttatgcacttgcaatgttt
aatgtggaaattgtatttatatcaccaagtgaattagaaatgccaccagaaattctcaga
gatttagagaaattaaattgtaaattttctattaaaaattctttaattgaaaatattgat
gatgtggatgttatatatatgactagaattcaaaaagaaagatttcctgatcctaaagaa
tatctaaaagtaaaaggtcaatacacattaactagtaaaaatttaaaagattctaatacc
atcataatgcatcctcttccaagagttgatgaaattgactttaatgtagataacctatca
aatgctatgtactttaagcaagcattttatggtgttccagtaaggatggcattgcttgat
tcaataataaaataa

DBGET integrated database retrieval system