KEGG   Methanosphaera stadtmanae: Msp_0224Help
Entry
Msp_0224          CDS       T00313                                 

Definition
cation transport ATPase
Orthology
K17686  
Cu+-exporting ATPase [EC:3.6.3.54]
Organism
mst  Methanosphaera stadtmanae
Brite
Enzymes [BR:mst01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.54  Cu+-exporting ATPase
     Msp_0224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(280802..283234)
Genome map
AA seq 810 aa AA seqDB search
MTKEDVFKVEDMACNACVNTITKTLSNNENISNISCNLESKDVSVTYDEEKVDVEEIISA
LDNIGFSATIKKKTLNIGGMTCVMCSKAVTSTISKMPGVYSIHVNLISETAEVIFNPTVV
TVKDIGDRINSIGYEYMGIHDNNSINNNIIEEKHNQNLRKKLHRIIVGFFFSAILMYLMF
SNFNFNGNESYIQLAITILPFIYVCSPIIISGINSIKHHNLNMDVMYTLGIGISFIASLL
STFGLLGESHFMLYDTSIMLGSFLMLGKYLEDRAKSKTSDSINKLVELKATEATIEKTIN
EKTITETVDINKVLKGNIVVIKPGEKIPLDGQIIEGKSYVDESLVTGESTPIEKNVGDVV
IGGSINKDGTFKFKVTNTGDKTVLSQIISMVQDAQNSSPPIQKLADKVITYFIPGILTIA
VICFIIWYVIYGSPLLYSLSIFISIVVVACPCALGLAIPTALTVGVGLAAKNGILIKDGQ
TLEVSQQITHVLLDKTGTITVGQPVLSNIINYSTESDEEVLMIARSIEQYSQHPIAQALF
NNQKKNEFELYDVDEFENISGKGVQATINNRDYIIGNKKILNDNNVPIPENILKDFENEE
LNMKTSIILADNKNIIAILSVSDVIKENSKKAIDQLHKMNIKTTMISGDNKNTSSIVAKQ
VGISNVVSEVLPQEKLDYVKKLQSEGEIVAFIGDGINDAPSLTKSNVGIAIGTGTDVAIE
SGDIILINGDLLNAVASIQISRKTMSRVRLNLFWAFAYNVVLIPIAAGALIPWNILFRPE
YSALAMALSSVTVITLSLLLRSYVPEIFRE
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atgactaaagaagatgttttcaaagttgaagatatggcatgtaatgcttgtgttaacaca
atcacaaaaacactaagtaacaatgaaaatattagtaacatctcatgcaatcttgaatca
aaagatgtatcagtaacatatgatgaagaaaaagtagatgttgaagaaataataagtgcc
cttgataatataggatttagtgcaactatcaaaaaaaaaaccttaaacataggtggaatg
acctgtgtaatgtgttcaaaagctgtaacctccacaatttcaaaaatgcccggagtttat
tcaatacatgttaatcttatctctgaaacagcagaagttatttttaatcctactgttgta
acagttaaagatattggggataggattaatagtattggttatgaatatatgggtattcat
gacaataattctattaataacaatataattgaagaaaaacataaccagaatctaagaaaa
aaactccatagaattattgttggattcttcttttcagcaattttaatgtatttaatgttt
agtaactttaattttaatggaaatgaatcatacatacaactagcaataacaatactacca
tttatctatgtatgttcccctattataatatcaggaattaattccattaaacatcataac
ctaaacatggatgtaatgtacacattaggtattggaatttcatttatagcaagtctactt
agtacatttggcctacttggagaatcacatttcatgttatatgatacaagtattatgctt
ggttctttcttaatgctaggaaaatatcttgaagatagagcaaaatcaaaaacatcagat
tcaataaataaattagttgaattaaaagcaacagaagctacaatagaaaaaacaataaat
gaaaaaacaataacagaaactgttgatattaacaaggtattaaagggcaatattgttgtt
ataaaacctggtgaaaaaatacccttagatggacagataatagaaggaaaaagttatgtt
gatgaatcattagtaacaggagaaagtacaccaatagaaaaaaatgtgggagatgttgta
attggtggatctataaataaggatggaacatttaaattcaaagtaacaaatactggtgat
aaaacagtactttcacaaattatatcaatggtacaagatgcacaaaattcaagtcctcca
atacaaaaacttgcagataaggtaattacatacttcattccaggaatactaacaatagca
gttatctgttttattatatggtatgttatatatggtagtccactactctatagtttaagt
atattcatatcaattgttgttgtggcctgtccatgtgcacttggacttgctattccaaca
gcactaacagttggagttggacttgctgctaaaaatggtatattaataaaggatggtcaa
acacttgaagtatcacaacaaataacacatgtactacttgataaaactggtacaattact
gttggtcaacccgtattatctaatataataaattattctacagaaagtgatgaggaagta
cttatgattgcccgttcaatagaacaatattcacaacacccaattgctcaggcacttttt
aataaccaaaaaaagaatgaatttgaattatatgatgttgatgagtttgaaaatatttca
ggaaaaggagttcaagctacaataaataatagagactatattattggtaataaaaaaata
cttaatgataataacgtacctattcctgaaaatatattgaaagattttgaaaatgaagaa
cttaatatgaaaacaagtatcattcttgcagataataaaaatatcatagcaattctttca
gtaagtgatgttataaaagaaaatagtaaaaaagctattgatcaattacataaaatgaat
attaaaaccacaatgattagtggagataataaaaatacttcatccattgttgcaaaacaa
gtaggtattagtaatgtagtctcagaagttcttccacaagaaaaactcgactatgttaaa
aaactacaaagtgaaggtgagattgttgcctttattggtgatggtattaatgatgctcca
tcccttacaaaatctaatgttggaattgcaataggtacaggtactgatgttgcaatagaa
tctggagatattatattgattaatggggatttattaaatgctgttgcatcaattcaaata
agtagaaaaactatgagtcgtgttagattaaatcttttctgggcatttgcatacaatgtt
gttttaattcctattgctgctggtgctcttataccctggaatatattatttagaccagaa
tacagtgcacttgccatggctttaagttctgtaactgtaattacattatcacttctactt
agaagttatgttccagaaatttttagagaatag

DBGET integrated database retrieval system