KEGG   Methanosphaera stadtmanae: Msp_0252Help
Entry
Msp_0252          CDS       T00313                                 

Definition
(GenBank) predicted ribokinase
  KO
K22026  
nucleoside kinase [EC:2.7.1.73 2.7.1.213 2.7.1.-]
Organism
mst  Methanosphaera stadtmanae
Pathway
Purine metabolism
Pyrimidine metabolism
Brite
KEGG Orthology (KO) [BR:mst00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Msp_0252
   00240 Pyrimidine metabolism
    Msp_0252
Enzymes [BR:mst01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.73  inosine kinase
     Msp_0252
    2.7.1.213  cytidine kinase
     Msp_0252
    2.7.1.-  
     Msp_0252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(310945..311871)
Genome map
AA seq 308 aa AA seqDB search
MKNVDLLVLGHTAFDYIMQVREFSKINTSAIIDNMETLHGGAAGNVAVVASKMGLDVGLI
SCVGNDFEDSDYKKELLNENIDISDMILSQEHKTPTAFCLTNPDDEQMFYFYWGAAKKYH
ESPVPKEAIDKAKAVHLATGDPEYNIKAGKYAYSQNKLVSFDPGQDLHLYSTNDLKEVVA
NCNILFGNEHEIEHICDLLEKNIDELMKNGPNMIIQTLGEKGSLIYVKGEDPLKIEAVPT
KSFDPTGAGDSYKAAFLSLYLRDNNLKTCGRFASTVSSYIVETQGTQTNIPTREQALIKM
NDTWPNEE
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgtagatttactagtattaggacatactgcttttgattatattatgcaagta
agagaattttcaaaaattaatacctcagctataatagataatatggaaacattacatggt
ggagctgctggtaatgttgctgttgttgcaagtaaaatgggattagatgttggtcttata
tcctgtgttggtaatgactttgaagatagtgattataaaaaagaattacttaatgaaaat
attgacatatctgatatgatactatcccaagaacataaaacacctacagcattttgttta
acaaatcctgatgatgaacaaatgttttatttctattggggagctgctaaaaaatatcat
gaaagtccagtacctaaagaagctattgataaagctaaagctgtgcatcttgcaacagga
gaccctgaatataatataaaagcaggaaaatatgcttattcacaaaataaattagtatca
ttcgatccaggacaggatttacatctctatagtactaatgatttaaaagaagtagttgct
aattgtaatatattatttggtaatgaacatgaaattgaacatatctgtgatttactagag
aaaaatattgatgaattaatgaaaaatggaccaaatatgattattcaaacacttggtgaa
aaaggaagtttaatctatgttaaaggagaagatccattaaaaatagaagccgtacctacc
aaatcattcgaccctactggtgctggtgattcatacaaggcagcatttttaagtttatat
ttaagagacaataaccttaaaacatgtggtagatttgcaagtactgtatcatcatatatt
gtagaaacccagggtacacagacaaatattccaactagagaacaagcacttattaagatg
aatgacacatggcccaatgaggaataa

DBGET integrated database retrieval system