KEGG   Methanosphaera stadtmanae: Msp_0266Help
Entry
Msp_0266          CDS       T00313                                 

Definition
acyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mst  Methanosphaera stadtmanae
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mst00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Msp_0266
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Msp_0266
   00620 Pyruvate metabolism
    Msp_0266
   00640 Propanoate metabolism
    Msp_0266
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Msp_0266
   00680 Methane metabolism
    Msp_0266
Enzymes [BR:mst01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Msp_0266
Lipid biosynthesis proteins [BR:mst01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Msp_0266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
330864..332537
Genome map
AA seq 557 aa AA seqDB search
MTSLLNRYVPRTEFDSYEDFNENLKITVPEDFNFAYDIVDVYAKEQPDKVALSWCDDNQE
KIFTFSNLKQLSDKAANFFKSLGVTKGDRVLLTLKSRYDFWYCMLALHKLKAIAVPATHM
LKPEDIEYRIDVAGIKTVVTIREDGVPESYAEVEKTLGLKLNKVFVGTEDMPGWYDLRKE
VKKASDNFERPVYDDDSVEDTSVIFFSSGSTGQPKMIKHSFGYPLAHIVTSNYWHQVVDN
GLHYTIADTGWGKALWGEIYGPWISGSGIYIYDYDRFHPYEVLSKALEHKITTLCCPPTM
YRFFIKEDIDNLDFSSLQHATTAGEPLNDEVFYKFKELTGLSIREAFGQTETVATIANFP
WVDIKLGSMGKPAPLFNIKLLNTDGCECDVGEEGEIVFDISEGYPLGLFKGYYNNQEKTD
ETIYDGYYHTGDSAWIDEDGYYWYKGRIDDVIKSSGYKIGPYEVESALLSHSAVLDCAVT
GIPHPIRGQIVKATIVLDKGYQPSQELTKDIQNHVKHVTAPYKYPRAIEYVDELPKTISG
KIMRKKIRLEDEEKFKK
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgacatcattattaaatagatatgttccaagaacagaatttgattcttatgaagatttt
aatgagaatttaaaaataacagtacctgaagattttaattttgcatatgatattgttgat
gtatatgcaaaagaacaacctgataaagtagcactatcatggtgtgatgataatcaagaa
aaaatattcacattcagtaatttaaaacaattaagtgataaggctgcaaacttctttaaa
tcattaggagttacaaagggtgatagagtattattaacacttaaaagtcgttatgatttt
tggtattgtatgttagcattacataaattaaaagcaatagcagtacctgcaacacacatg
ttaaaacctgaagatattgaatataggatagatgttgctggaattaaaactgttgtaact
attcgtgaagatggtgttccagaaagctatgctgaagttgaaaaaacattaggtcttaag
ttaaacaaagtatttgttggaacagaagatatgcctggatggtatgatttaagaaaagaa
gttaaaaaagcttcagataactttgaacgtccagtatatgatgatgattcagttgaagat
acttctgtaattttcttctcatcaggttcaacaggacaaccaaaaatgattaaacacagt
tttggatatccattagcacatattgtaacttccaattactggcatcaggtggtggataat
ggattacattacaccatagcagatactggttggggaaaagcattatggggtgaaatatat
ggtccatggatttcaggttcaggaatatatatctatgattatgatagattccacccatat
gaagttttatctaaggcattagaacataaaatcacgacattatgttgtccaccaacaatg
tacaggttctttataaaagaagatattgataacttggacttttcttcattacaacatgca
acaactgctggtgaaccattaaatgatgaagtattctataaatttaaggaattaacaggt
ctatctatacgtgaagcatttggtcaaacagaaacagtagctactattgcaaacttccca
tgggttgatattaaattaggttcaatgggtaaacctgcaccattgttcaatattaaattg
ttaaatactgatggatgtgaatgtgatgttggtgaagaaggtgaaatagtatttgatatt
tctgaaggttatccattaggattatttaaaggatactataataaccaagaaaagactgat
gaaacaatatatgatggatattatcatacaggggattctgcatggattgatgaagatgga
tattactggtataaaggtagaattgatgatgtaattaaaagttctggatataagataggt
ccatatgaagttgaaagtgcattactatcacatagtgcagtattagactgtgcagtaact
ggtatacctcatcctataagaggacaaattgttaaggcaacaattgttttagataagggt
tatcaaccatctcaggagttaacaaaagatattcaaaatcatgtaaaacatgttacagca
ccatataaatatcctcgtgcaattgaatatgttgatgaacttccaaaaacaattagtggt
aaaataatgaggaaaaaaatcagacttgaagatgaagaaaaattcaagaaataa

DBGET integrated database retrieval system