KEGG   Methanosphaera stadtmanae: Msp_0266Help
Entry
Msp_0266          CDS       T00313                                 

Definition
(GenBank) predicted acyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mst  Methanosphaera stadtmanae
Pathway
mst00010  Glycolysis / Gluconeogenesis
mst00620  Pyruvate metabolism
mst00640  Propanoate metabolism
mst00680  Methane metabolism
mst00720  Carbon fixation pathways in prokaryotes
mst01100  Metabolic pathways
mst01110  Biosynthesis of secondary metabolites
mst01120  Microbial metabolism in diverse environments
mst01130  Biosynthesis of antibiotics
mst01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mst00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Msp_0266
   00620 Pyruvate metabolism
    Msp_0266
   00640 Propanoate metabolism
    Msp_0266
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Msp_0266
   00680 Methane metabolism
    Msp_0266
Enzymes [BR:mst01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Msp_0266
Lipid biosynthesis proteins [BR:mst01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Msp_0266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABC56682
UniProt: Q2NHF1
Position
330864..332537
Genome map
AA seq 557 aa AA seqDB search
MTSLLNRYVPRTEFDSYEDFNENLKITVPEDFNFAYDIVDVYAKEQPDKVALSWCDDNQE
KIFTFSNLKQLSDKAANFFKSLGVTKGDRVLLTLKSRYDFWYCMLALHKLKAIAVPATHM
LKPEDIEYRIDVAGIKTVVTIREDGVPESYAEVEKTLGLKLNKVFVGTEDMPGWYDLRKE
VKKASDNFERPVYDDDSVEDTSVIFFSSGSTGQPKMIKHSFGYPLAHIVTSNYWHQVVDN
GLHYTIADTGWGKALWGEIYGPWISGSGIYIYDYDRFHPYEVLSKALEHKITTLCCPPTM
YRFFIKEDIDNLDFSSLQHATTAGEPLNDEVFYKFKELTGLSIREAFGQTETVATIANFP
WVDIKLGSMGKPAPLFNIKLLNTDGCECDVGEEGEIVFDISEGYPLGLFKGYYNNQEKTD
ETIYDGYYHTGDSAWIDEDGYYWYKGRIDDVIKSSGYKIGPYEVESALLSHSAVLDCAVT
GIPHPIRGQIVKATIVLDKGYQPSQELTKDIQNHVKHVTAPYKYPRAIEYVDELPKTISG
KIMRKKIRLEDEEKFKK
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgacatcattattaaatagatatgttccaagaacagaatttgattcttatgaagatttt
aatgagaatttaaaaataacagtacctgaagattttaattttgcatatgatattgttgat
gtatatgcaaaagaacaacctgataaagtagcactatcatggtgtgatgataatcaagaa
aaaatattcacattcagtaatttaaaacaattaagtgataaggctgcaaacttctttaaa
tcattaggagttacaaagggtgatagagtattattaacacttaaaagtcgttatgatttt
tggtattgtatgttagcattacataaattaaaagcaatagcagtacctgcaacacacatg
ttaaaacctgaagatattgaatataggatagatgttgctggaattaaaactgttgtaact
attcgtgaagatggtgttccagaaagctatgctgaagttgaaaaaacattaggtcttaag
ttaaacaaagtatttgttggaacagaagatatgcctggatggtatgatttaagaaaagaa
gttaaaaaagcttcagataactttgaacgtccagtatatgatgatgattcagttgaagat
acttctgtaattttcttctcatcaggttcaacaggacaaccaaaaatgattaaacacagt
tttggatatccattagcacatattgtaacttccaattactggcatcaggtggtggataat
ggattacattacaccatagcagatactggttggggaaaagcattatggggtgaaatatat
ggtccatggatttcaggttcaggaatatatatctatgattatgatagattccacccatat
gaagttttatctaaggcattagaacataaaatcacgacattatgttgtccaccaacaatg
tacaggttctttataaaagaagatattgataacttggacttttcttcattacaacatgca
acaactgctggtgaaccattaaatgatgaagtattctataaatttaaggaattaacaggt
ctatctatacgtgaagcatttggtcaaacagaaacagtagctactattgcaaacttccca
tgggttgatattaaattaggttcaatgggtaaacctgcaccattgttcaatattaaattg
ttaaatactgatggatgtgaatgtgatgttggtgaagaaggtgaaatagtatttgatatt
tctgaaggttatccattaggattatttaaaggatactataataaccaagaaaagactgat
gaaacaatatatgatggatattatcatacaggggattctgcatggattgatgaagatgga
tattactggtataaaggtagaattgatgatgtaattaaaagttctggatataagataggt
ccatatgaagttgaaagtgcattactatcacatagtgcagtattagactgtgcagtaact
ggtatacctcatcctataagaggacaaattgttaaggcaacaattgttttagataagggt
tatcaaccatctcaggagttaacaaaagatattcaaaatcatgtaaaacatgttacagca
ccatataaatatcctcgtgcaattgaatatgttgatgaacttccaaaaacaattagtggt
aaaataatgaggaaaaaaatcagacttgaagatgaagaaaaattcaagaaataa

DBGET integrated database retrieval system