KEGG   Methanosphaera stadtmanae: Msp_0334Help
Entry
Msp_0334          CDS       T00313                                 

Gene name
porC
Definition
pyruvate ferredoxin oxidoreductase subunit gamma (EC:1.2.7.1)
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
mst  Methanosphaera stadtmanae
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mst00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Msp_0334 (porC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Msp_0334 (porC)
   00020 Citrate cycle (TCA cycle)
    Msp_0334 (porC)
   00620 Pyruvate metabolism
    Msp_0334 (porC)
   00640 Propanoate metabolism
    Msp_0334 (porC)
   00650 Butanoate metabolism
    Msp_0334 (porC)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Msp_0334 (porC)
   00680 Methane metabolism
    Msp_0334 (porC)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Msp_0334 (porC)
Enzymes [BR:mst01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Msp_0334 (porC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
396305..396847
Genome map
AA seq 180 aa AA seqDB search
MIEIRFHGRGGQGAVTAAEILAKAVFEEGKYTQAFPSFGVERRGAPVTAFARISDKPIRR
RYQIYSPKYVVVLDDTLVNVVDVTSGILDDGSILLNSTNNDLSVFEEKNIDASVVDATGV
ALDIIGRNIVNTTMLGFLAAKTGVVSLDSLLKTIDDTFKGKVASVNKEATEFIYNKYANE
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaataagatttcatggaagagggggccaaggagctgtaactgcagctgaaatt
ttagctaaagcagtttttgaggaaggtaaatatactcaagctttcccttcatttggtgta
gaaagaagaggagcaccagtaacagcattcgctagaattagtgataaaccaataagaaga
cgatatcaaatatactcacctaaatatgtggtagtattggatgataccttagtaaatgtg
gtagatgtaacatcaggaatattggatgatggttcaatattacttaactcaacaaataat
gatttatcagtatttgaagaaaaaaatattgatgcaagtgtcgttgatgctacaggagtg
gcattagatattattggaagaaatattgtaaatacaacaatgttaggtttcttagcagct
aaaactggagtagtgtctctagattccttattaaaaacaatagatgatacatttaaagga
aaagtagctagtgtaaacaaagaagctacagaatttatttacaataaatatgcaaatgaa
taa

DBGET integrated database retrieval system