KEGG   Methanosphaera stadtmanae: Msp_0335Help
Entry
Msp_0335          CDS       T00313                                 

Gene name
porD
Definition
(GenBank) PorD
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
mst  Methanosphaera stadtmanae
Pathway
mst00010  Glycolysis / Gluconeogenesis
mst00020  Citrate cycle (TCA cycle)
mst00620  Pyruvate metabolism
mst00640  Propanoate metabolism
mst00650  Butanoate metabolism
mst00680  Methane metabolism
mst00720  Carbon fixation pathways in prokaryotes
mst01100  Metabolic pathways
mst01120  Microbial metabolism in diverse environments
mst01130  Biosynthesis of antibiotics
mst01200  Carbon metabolism
Module
mst_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mst_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mst00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Msp_0335 (porD)
   00020 Citrate cycle (TCA cycle)
    Msp_0335 (porD)
   00620 Pyruvate metabolism
    Msp_0335 (porD)
   00640 Propanoate metabolism
    Msp_0335 (porD)
   00650 Butanoate metabolism
    Msp_0335 (porD)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Msp_0335 (porD)
   00680 Methane metabolism
    Msp_0335 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Msp_0335 (porD)
Enzymes [BR:mst01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Msp_0335 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_6 Fer4_21 Fer4_2 Fer4_9 Fer4_7 Fer4_16 Fer4_10 Fer4_13 Fer4_4 Fer4_17 Fer4_8 Fer4_15 Fer4_22 Fer4_3 Fer4_18
Motif
Other DBs
NCBI-ProteinID: ABC56745
UniProt: Q2NHX1
Position
396863..397105
Genome map
AA seq 80 aa AA seqDB search
MVAKGAVVKEPGSTRKNKTGSWRTFKPVADKDKCISCGLCYLFCPDGCISVEFNHDYDYC
KGCGICAEECPVDAIKMVRE
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
atggtagcaaaaggagcagttgttaaagaacctggaagtactagaaaaaataaaactggt
agttggaggacatttaaacctgttgcagataaagataaatgtataagctgtggtctttgt
tatttattctgtccagatggttgtatttcagtagaatttaatcatgattatgactattgt
aaaggttgtggaatatgtgcagaggaatgtccagttgacgcaattaaaatggtgagggaa
taa

DBGET integrated database retrieval system