KEGG   Methanosphaera stadtmanae: Msp_0335Help
Entry
Msp_0335          CDS       T00313                                 

Gene name
porD
Definition
hypothetical protein
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
mst  Methanosphaera stadtmanae
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mst00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Msp_0335 (porD)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Msp_0335 (porD)
   00020 Citrate cycle (TCA cycle)
    Msp_0335 (porD)
   00620 Pyruvate metabolism
    Msp_0335 (porD)
   00640 Propanoate metabolism
    Msp_0335 (porD)
   00650 Butanoate metabolism
    Msp_0335 (porD)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Msp_0335 (porD)
   00680 Methane metabolism
    Msp_0335 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Msp_0335 (porD)
Enzymes [BR:mst01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Msp_0335 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
396863..397105
Genome map
AA seq 80 aa AA seqDB search
MVAKGAVVKEPGSTRKNKTGSWRTFKPVADKDKCISCGLCYLFCPDGCISVEFNHDYDYC
KGCGICAEECPVDAIKMVRE
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
atggtagcaaaaggagcagttgttaaagaacctggaagtactagaaaaaataaaactggt
agttggaggacatttaaacctgttgcagataaagataaatgtataagctgtggtctttgt
tatttattctgtccagatggttgtatttcagtagaatttaatcatgattatgactattgt
aaaggttgtggaatatgtgcagaggaatgtccagttgacgcaattaaaatggtgagggaa
taa

DBGET integrated database retrieval system