KEGG   Methanosphaera stadtmanae: Msp_0336Help
Entry
Msp_0336          CDS       T00313                                 

Gene name
porA
Definition
hypothetical protein
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
mst  Methanosphaera stadtmanae
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mst00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Msp_0336 (porA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Msp_0336 (porA)
   00020 Citrate cycle (TCA cycle)
    Msp_0336 (porA)
   00620 Pyruvate metabolism
    Msp_0336 (porA)
   00640 Propanoate metabolism
    Msp_0336 (porA)
   00650 Butanoate metabolism
    Msp_0336 (porA)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Msp_0336 (porA)
   00680 Methane metabolism
    Msp_0336 (porA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Msp_0336 (porA)
Enzymes [BR:mst01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Msp_0336 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
397108..398247
Genome map
AA seq 379 aa AA seqDB search
MVKKVISSAEAVSEAVKRARPSVIPVYPITPQTKISEKLADYVADGDLDAHYIKVESEHS
AMSAAIGASGAGVRVFTATSSQGLAYMHEPVFAAAGMRVPIVMANANRALSAPINIWNDQ
QDSISERDSGWIQLYAETGQEAFDTILQAYKISENQDILLPTMVCIDGFILTHTVDPVEV
LSQEEVDSFLPKYTRGYSYLDPEDPMSLGTLADTESYLEIRHDMEIAMEHSLDVIEEVGK
EFGDLFGRYYGLIEEYKSEDADIILIAMGSLCGTIKDVVDKERENGKKVGLVRIRSYRPF
PKDALKVAVKDAKLAVIDKDISFGAGGAVYMDVKAALDNETYGFIIGLGGRDITPIDIEE
IIEKTENPTKDIEWIGLRE
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggttaaaaaagttatatcatctgcagaagcagtatctgaagcagtaaaacgtgcaaga
cctagtgttatacctgtatatccaattacaccacaaacaaaaatatctgaaaaattagca
gattatgttgctgatggtgatttggatgctcattatataaaagtagaatcagaacacagt
gcaatgagtgcagcaataggtgcatcaggagctggtgtaagagtatttacagctacatca
agtcaaggattagcatatatgcatgaaccagtatttgcagcagctggtatgagagtacca
atagtaatggctaatgcaaatcgtgcattatcagcacctattaacatatggaatgatcaa
caagattcaatatctgaaagagatagtggatggatacagttatatgcagaaactggtcaa
gaggcatttgatacaatattacaagcatataaaatatctgaaaatcaggatatcttatta
cctacaatggtatgtatagatggatttatattaacacacactgtagatcctgttgaagta
ttatcacaagaagaagtagattcattcctaccaaaatatacaagaggatattcatatctt
gacccagaagatccaatgtctttaggaacattagcagatacagaatcatacctagaaatt
agacatgacatggaaatagctatggaacactcattagatgttattgaagaagtaggtaaa
gaatttggtgacttatttggaagatactatggtcttattgaagaatataaatctgaagat
gcagacataatcctaatagcaatgggttcactttgtggaacaataaaagatgttgttgac
aaagaaagagaaaatggtaaaaaagtaggattagtaagaataagatcatacagaccattc
ccaaaagatgctttaaaagtagcagttaaagatgcaaaattagctgttattgataaagat
atatcctttggtgcaggtggagctgtatatatggatgtaaaagcagcacttgataatgaa
acatatggtttcataataggtctaggtggaagagacataactccaatagatatagaagaa
atcattgaaaaaaccgaaaatccaacaaaagatatagaatggataggattaagggagtag

DBGET integrated database retrieval system