KEGG   Methanosphaera stadtmanae: Msp_0372Help
Entry
Msp_0372          CDS       T00313                                 

Definition
histone acetyltransferase
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mst  Methanosphaera stadtmanae
Brite
Enzymes [BR:mst01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Msp_0372
Transfer RNA biogenesis [BR:mst03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Msp_0372
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
438763..440388
Genome map
AA seq 541 aa AA seqDB search
MQEACRLIIEEALSRNITTKKDLEKLKIQTCRDLKLSGFMSNSKILQYAKPEELESLRPI
LMKKPTRTISGVAIVAVMCRPHKCPHGRCKYCPESSIAPPSYTGEEPAALRARMFHFHPY
VQTFNRLYQLKNIGHSIDKVELIIMGGTFASCTLDYQEWFVTQCLRAMNDFETVSKKIPV
NQREIKIIPPEDFQYIHDAQKNNEHSKVRCIGLTFETRPDYAKMEDINRMLQFGVTRVEL
GVQTLYNHIYKRVDRGHKIQDVIEANQLLRDSGIKVAMHMMPGLLSSFSSDVNMFKRLFN
EPLFSPDMLKIYPCLVTEGSEFYDMWKKGEYEPYTSQQAVDLIVEVKKILPKWVRTMRIQ
RDIPATLIDAGVKKSNLGELVYNRLEEEDIQCQCIRCREVGHKKAHGIEPDYNNIELLRT
DYDVVGGHEIFLSIEDVENDILIGFTRLRIPSNRVFRKEITSSSSLIRELHVYGQMQKIG
KNDDNLWQHKGYGAQLLEEAEKIAKDEYNKNKMLIISGIGVRDYYRKFGYYKDGPYMSKF
I
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaagcgtgtagattaataatagaagaagcattaagtagaaatataactacaaag
aaggatttagaaaaacttaaaattcaaacatgtagagacttaaaattaagtggcttcatg
agtaattctaaaattttacagtatgcaaaaccagaagaattagaaagtttaagaccaatt
ctaatgaaaaaaccaacacgtacaatttctggtgttgcaatagtagcagttatgtgtagg
ccacataaatgtccacatggacgatgtaaatactgtcctgagagtagcattgctcctcca
agttatactggtgaggaacctgcagctttacgagcaagaatgttccattttcatccatat
gttcaaacattcaacagattatatcaactaaaaaatattggtcattccatagataaggtg
gaattaataataatgggcggaacctttgcttcatgtactcttgattatcaggaatggttt
gtaacacaatgtttaagggcaatgaatgattttgaaacagttagtaagaaaataccagta
aatcaaagggaaatcaaaataatacctccagaggatttccaatacatacatgatgcacag
aaaaataatgaacattcaaaggtaagatgtataggattaacatttgaaacaagaccagat
tatgctaaaatggaagatattaatagaatgttacaatttggagtaacacgtgttgaatta
ggtgttcaaacattatataatcatatatataaacgagttgatagaggtcataaaattcaa
gatgtaatagaggcaaatcaattattacgagattctggaataaaagttgccatgcatatg
atgccaggacttttatcttcatttagtagtgatgttaacatgtttaaacgtttatttaat
gaaccattattttcaccagacatgttaaaaatctatccatgtcttgttacagagggctca
gaattctatgatatgtggaaaaagggcgaatatgaaccatacacatctcaacaagcagtg
gatttaatagttgaagttaaaaaaattctaccaaaatgggttagaacaatgagaattcaa
agagatattccagcaacattaattgatgctggagttaaaaaatcaaatcttggagaatta
gtatataatcgtcttgaagaggaggatattcaatgtcaatgtattagatgtagagaggta
ggtcataaaaaggcacatggaatagaacctgactataataatatagaattactaagaaca
gattatgatgtagtaggtggacatgaaatatttttatctatagaagatgtggaaaatgat
attttaattggatttactcgtttaagaataccatccaatagagtatttaggaaggaaatt
acaagttcaagttcattgattagagaattacatgtttatggacaaatgcagaaaattggt
aaaaatgatgataatttatggcaacataaaggttatggtgcccaattattagaagaagct
gaaaaaatagcaaaagatgaatataataaaaataaaatgctaataattagtggaattggt
gtaagagattattatcgtaaatttggatattataaggatggtccatacatgtctaaattc
atttaa

DBGET integrated database retrieval system