KEGG   Methanosphaera stadtmanae: Msp_0415Help
Entry
Msp_0415          CDS       T00313                                 

Definition
arginase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mst  Methanosphaera stadtmanae
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mst00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Msp_0415
Enzymes [BR:mst01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Msp_0415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
477546..478433
Genome map
AA seq 295 aa AA seqDB search
MFFYADNMMNFAFSKSIDNEEEIEEGYAIMGVGFDSTTSYMAGSRYGPKAVREASYNFES
YNLSFDTSLTACSYDIGDVFVNTGNYETTHVMIKDTVKSILEMDLYPIVIGGEHTITNGV
LGGIYDFNEDLFHNLTVVHFDAHFDMRDTYLDEKYSHATVLRRIHEHKPQQIIQLGIRSA
QKEEYEYVKQQDNISYYTNHDIKENKNEILKVLEKIDTPIYITVDIDVLDPAYAPSVGTP
APCGITPYDLEDMIGVLSKKNVVGIDVVEVSSNTIGDTTSINAAKVIYDFLSLQD
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgtttttttatgcagataatatgatgaattttgctttttcaaaatctatagataatgaa
gaggaaatagaggaaggttatgctattatgggtgttggatttgacagtacaacaagttac
atggcaggttcaaggtatggtccaaaggctgttagagaagcttcatataattttgaatca
tataatttatcatttgatacttcactaactgcttgtagttatgatattggagatgtgttt
gtaaatacaggaaattatgaaacaacacatgttatgattaaagatactgtaaaatccatc
cttgagatggatttgtatcctattgtaatagggggagaacacacaattacaaatggtgtt
cttggtggtatatatgattttaatgaggatctttttcataatttaacagtagtgcatttt
gatgctcattttgatatgagagatacatatcttgatgagaaatattcacatgcaacagta
cttagaagaatccatgaacacaaaccccaacaaataatacaactaggtatacgatcagca
caaaaagaagaatatgaatatgtaaaacaacaagataacatatcatactatacaaatcat
gatattaaagaaaataagaacgaaatactaaaagtattagaaaaaatagatacacccatt
tatattacagtagatattgatgtcctagatccagcatatgcaccctctgtaggaacacca
gcaccatgtggaattacaccatatgatttggaggatatgattggagtactttcaaaaaag
aatgtagtgggtattgatgtggttgaagtttcatcaaatacaataggagatacaacaagt
ataaatgcagcaaaggtaatctatgactttttatcactacaagactaa

DBGET integrated database retrieval system