KEGG   Methanosphaera stadtmanae: Msp_0416Help
Entry
Msp_0416          CDS       T00313                                 

Gene name
hemB
Definition
(GenBank) HemB
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
mst  Methanosphaera stadtmanae
Pathway
mst00860  Porphyrin and chlorophyll metabolism
mst01100  Metabolic pathways
mst01110  Biosynthesis of secondary metabolites
mst01120  Microbial metabolism in diverse environments
Module
mst_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mst00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Msp_0416 (hemB)
Enzymes [BR:mst01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Msp_0416 (hemB)
Exosome [BR:mst04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Msp_0416 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ABC56817
UniProt: Q2NH86
Position
478510..479475
Genome map
AA seq 321 aa AA seqDB search
MFPVTRMRRMRSDERIRSMFRETSVDISDFIYPLYIKESTENGNPEEISTMPGQYRYSVD
DAVDFAGLLEDDGLTSVILFGIPDYKDEKASSAYDKNGIIQQTIKALKEQTNLVVLGDVC
MCEYTDHGHCGIIKDNYVQNDETLKYLSKIAVSYADAGVDVVAPSDMMDGRVGAIREALD
KNDYINTPIFSYAAKYASTYYAPFRDAADSTPSFGDRKSYQMDPANFNEAIREVALDVQE
GTDAIIVKPALAYLDVLREVKQTFKMPTIAYQVSGEYSMIQAGIEKGYITEDLLYETLLS
IKRAGADMIISYFVPQLLGIE
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgtttccagttacaagaatgagaagaatgagatcagatgaaagaataagaagcatgttt
cgtgaaacaagtgtagatattagtgattttatatatccactatatattaaagaatcaaca
gaaaatggaaatcctgaagaaataagtacaatgcccggtcaatacagatattctgttgat
gatgcagtagattttgcaggacttcttgaagatgatggtttaacatcagtaatactcttt
ggaataccagattataaagatgaaaaagcatccagtgcatatgataaaaatggtataatt
caacaaacaatcaaagcattaaaagaacaaacaaacctagttgttttaggtgatgtttgt
atgtgtgaatatacagatcatggacattgtggtataataaaagataactatgttcaaaac
gatgaaacactaaaatatctatcaaaaatagcagtaagctatgcagatgcaggagtagat
gtagtagcaccaagtgatatgatggatggaagagtaggtgcaattcgtgaagcactagat
aaaaatgattatatcaatactccaatattttcatatgcagcaaaatatgcatccacatac
tatgcaccatttagggatgcagcagattcaactccaagctttggtgatcgtaaatcctat
caaatggatccagcaaatttcaatgaagcaattagagaagtagcattagatgttcaagaa
ggaacagatgctattattgttaaaccagcactagcatatttagatgtcttacgtgaagta
aaacaaacatttaaaatgccaacaatagcataccaagtaagtggtgaatattcaatgata
caggcaggaatagaaaaaggatacattacagaagatttactatatgaaacactacttagt
ataaaacgtgctggagcagatatgattataagttattttgtaccacaactacttggtata
gaatag

DBGET integrated database retrieval system