KEGG   Methanosphaera stadtmanae: Msp_0473Help
Entry
Msp_0473          CDS       T00313                                 

Definition
type III restriction-modification system, restriction subunit (EC:3.1.21.5)
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
mst  Methanosphaera stadtmanae
Brite
Enzymes [BR:mst01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     Msp_0473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
554686..557673
Genome map
AA seq 995 aa AA seqDB search
MELNFESNLEYQQDAIGSIVDLFNGQASDNSPFQLGGFYRTTTLDDYGKTASNIGIGNRL
DLREDIILENIRKVQLKNEITPTDNINKSKLKFTVEMETGTGKTYVYLRSIFELNKNYGF
TKFIIVVPSLAIKEGVKKTLDITRNHFKGLYDNPIYNYFVYNSSRLNDIHNFVVDNNINI
MIINIDSFNKDLNLINQPQDTLQGNRPIDLIAQTNPFIIIDEPQSITAKKDGKGEQAIER
LNPLCTVSFSATPPDNSENYIYKLNAVDAYNKKLVKQIEVDSILSHNDHNSPYMKLVEVK
AKPYSAKIEIDANVKGVTKRKTVKVKNKTDLSDLSKREIYTGYIVDNIICSEGRESVEFT
NGERIKLNLAVGETNEKLIKRELIHYTIKEHLDKELRLLKKGIKVLSLFFIDKVANYRIY
DKEGNPNLGDYAVIFEEEYKKLIKEDKYKSLMEYNNINVDISQVHNGYFAQDKKGFKDTN
GKGKLDNDAYNLIMKDKERLLNMKTPLRFIFSHSALREGWDNPNVFQICTLNETRSKMKK
RQEIGRGLRLCVDQDGNRIKNNPNINILTVMANESYDQFAEGLQKEIEEDTGIKFNRITD
TSFSFTKYTNRKGDEEELGDQKSKLIYKYLEANGYIKKDGKILPQLEIDIEKGEFKLAPI
VEDIASDKEELRNNIINEIRTLTAPPIVKKRGDRKTIKLDYDKYKKEDFYKIWNKIKHKS
MYKVQFDTERLIEECSKRLHEELNIGNPTVIFTKAGYKIEYSGIEPQEEIWDVIESQGDS
VDLPNILQYLQNETTLTRKTLARILIQSETLNQFKKNPEEYKEQTLLIIKEELRRFLVDG
IAYTKIEDCYDEDEFERHELFRYVNELGEDDKSERSYKSPYEYTIFDSGIEKSFQEKLEF
SNLIKFYMKLPGWFEIDTPIGKYNPDWAILVEREGKEELYFIVETKGTSNIKELKPSEQY
KIKCGIEHFKALDESIQFEVESDFEEFKMDTISKY
NT seq 2988 nt NT seq  +upstreamnt  +downstreamnt
atggaattaaattttgaatcaaatttggaataccaacaagatgctattggttctattgta
gatttgtttaatggccaagcttctgataattccccttttcaacttggtggtttttataga
acaactactttagatgattatggtaaaacagccagtaatattggtattggaaatcgtctt
gatttacgtgaggacataatattagaaaatattagaaaggtacaattaaaaaatgaaatt
actcctacagacaacattaacaaaagtaaattaaaatttactgttgaaatggaaacagga
actggtaaaacttacgtttatcttagaagtatttttgaattaaataaaaattatggtttc
actaagtttattatagttgttcctagtcttgctatcaaagaaggagttaaaaaaacatta
gatataacacgaaaccacttcaaaggattatatgataatccaatttataattattttgtt
tataatagcagtagattaaatgatattcataattttgttgtggataacaatattaatatt
atgattattaatatagattcatttaataaggatttaaacttaataaatcaaccacaagat
acattacagggtaaccgcccgattgatttaattgctcaaacaaatccatttattattatt
gatgaacctcaatctatcactgctaaaaaagatggtaaaggtgaacaagctatcgaaaga
ttaaatcctttatgtacagtgagtttttcagcaacccctccagacaatagtgaaaactat
atttataaattaaatgctgtggatgcatataataaaaaattagttaaacagatagaagtt
gattctattttatcacataatgatcataattctccatatatgaaactagttgaagttaaa
gctaaaccttatagtgctaaaattgaaatagatgctaatgttaaaggtgtaactaaaaga
aaaactgtgaaagtcaaaaataaaactgatttatctgatttatctaaacgtgaaatttat
acgggatatattgttgataatatcatttgttctgaaggcagagaatctgtagaatttact
aatggagaacgaattaaattaaatcttgctgttggagaaactaatgaaaaacttattaag
cgagaattaattcattacacaattaaagaacatttagataaagagttacgccttcttaaa
aaaggtattaaagttttatcattattctttattgataaagtagcaaattatagaatctac
gataaagaaggaaatccaaatttaggagattacgctgtcatatttgaagaagaatataag
aaactaattaaagaagataaatacaaatcactcatggaatacaataatatcaatgtagat
attagtcaagttcataacggttattttgctcaagataaaaaaggttttaaagatacaaat
ggtaaaggaaaactagacaatgatgcttataatcttataatgaaagataaagaaagatta
ttaaatatgaaaactcctttaagatttattttctctcattctgctttacgagaaggatgg
gataatcctaatgtgttccaaatatgtactcttaatgaaactaggtcaaaaatgaaaaaa
cgacaagaaattggtcgtggtttaagattatgtgtagatcaagatggaaatagaattaaa
aataatccgaatattaatattttaactgttatggctaatgaaagttatgatcaatttgct
gaaggattacaaaaagaaattgaagaagatactggaattaaatttaatagaataactgac
acatcatttagtttcacaaaatatactaatagaaaaggtgatgaagaagagttaggtgat
cagaaatcaaaattaatctataaatatcttgaagcgaatggttatattaaaaaagatggt
aagatattacctcaacttgaaattgatattgagaagggtgaatttaaattagctccaata
gtagaagatattgccagtgataaagaagaattacgtaataatataataaatgaaattcgc
acattaactgcacctccaatagttaaaaaacgtggtgatagaaaaactataaaactagat
tatgacaagtataaaaaagaagatttctataaaatatggaataaaattaaacataaatcc
atgtataaagtacaatttgacacggaacgattaattgaagaatgttctaaacgtttgcat
gaagaattaaacattggtaatcctacggtaatatttactaaagcaggttataaaattgaa
tatagtggtattgaaccacaagaggaaatttgggatgtgattgaatcacagggagatagt
gtagatttaccaaacatattacaatatttacaaaatgaaactacacttactagaaaaacg
cttgcccgaattttaattcaaagtgaaactttaaatcaatttaagaaaaatcctgaagaa
tataaagaacaaactcttctaataatcaaagaggaattaagaagattcttagtagatgga
attgcatataccaaaattgaagattgctatgatgaagatgaatttgaaagacatgaactt
ttccgttatgttaatgaactaggagaagatgataaatcagaaagaagttataaatctcct
tatgaatacactatatttgattcaggtattgaaaaatcattccaagaaaaacttgaattc
agtaatttaattaaattttatatgaagttaccaggatggtttgaaatagatactcctata
ggtaaatataatccagactgggcaatattagtagaaagagaaggtaaagaagagttatat
ttcattgttgaaacaaaaggaacgagtaatattaaagaactaaaaccatccgaacaatac
aaaattaaatgtggaatagaacatttcaaagcattagatgaaagtatacaatttgaagtt
gaaagtgattttgaagaatttaaaatggacacaataagtaaatattaa

DBGET integrated database retrieval system