KEGG   Methanosphaera stadtmanae: Msp_0565Help
Entry
Msp_0565          CDS       T00313                                 

Definition
(GenBank) predicted M42 glutamyl aminopeptidase
Organism
mst  Methanosphaera stadtmanae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M42 Peptidase_M20 Peptidase_M28 DUF2642
Motif
Other DBs
NCBI-ProteinID: ABC56964
UniProt: Q2NGT9
Position
656234..657262
Genome map
AA seq 342 aa AA seqDB search
MKSLLKKLSEACGISGFEDEVREILKDELKDHVDDMETDIMGNLITTHKGKEGKPSVMLA
SHMDEIGLMVSFIDDDGYLRFVKIGGINDQMLLNQKVYVQTENGEVPGIIGSKPPHITSA
AEAKKIIPYKNMFIDIGAKDKEQAESLVSIGDAVVFHTEFEECLNDLVMGKALDNRVGCA
VMAEVMKQTDCDATVYGVGTVQEEVGLKGAKTSAFKLNPDMAIALDVTIAGDHPGVKPED
APVKAGKGPVISFADASGRGLLTHPMMKKLLVEAAEAADIDYQIEVGDGGTTDATAIHLT
REGIATATLSSGSRYIHTPISVVNVKDLEDTVKLILEFLKRL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtttattaaaaaaattatctgaagcttgtggaatttcaggcttcgaagatgaa
gtacgtgaaatcttaaaagatgaattaaaagatcatgttgatgatatggaaacagatatt
atgggtaatcttataacaacccataaaggtaaagaaggaaaacctagtgtaatgttagct
tcacatatggatgaaattggtcttatggtaagtttcattgatgatgatggatatttaaga
tttgttaaaattggtggaatcaacgatcaaatgttattaaatcagaaagtgtatgtacaa
acagaaaatggtgaagtacctggtattattggttccaaaccacctcatattacaagtgct
gctgaagctaaaaaaattattccatacaaaaatatgtttatagatattggagctaaagac
aaagaacaagcagaaagtcttgtttctattggagatgctgttgtattccatactgaattt
gaagaatgtttaaacgatcttgtaatgggtaaagcattagataaccgtgtaggttgtgct
gttatggcagaagtaatgaaacaaacagattgtgatgcaacagtatatggtgttggaaca
gtacaggaagaagtaggattaaaaggagctaaaacatcagcattcaagttaaatcctgat
atggctattgcattagatgtaaccattgctggagatcatcctggagtaaaacctgaagat
gctcctgtaaaagcaggaaaaggtcctgtaatatcatttgctgatgctagtggtagagga
ttattaactcatcctatgatgaaaaaattattagttgaagctgctgaagctgctgatatt
gattaccaaatagaagtaggtgatggtggaacaactgatgcaacagcaattcaccttact
cgtgaaggtatagcaactgcaactttatcaagtggttcaagatatattcacacacctatt
agtgttgtaaatgtaaaagatttagaagacacagtaaaactcatacttgaattcttaaaa
agattataa

DBGET integrated database retrieval system