KEGG   Methanosphaera stadtmanae: Msp_0565Help
Entry
Msp_0565          CDS       T00313                                 

Definition
M42 glutamyl aminopeptidase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mst  Methanosphaera stadtmanae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mst00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
656234..657262
Genome map
AA seq 342 aa AA seqDB search
MKSLLKKLSEACGISGFEDEVREILKDELKDHVDDMETDIMGNLITTHKGKEGKPSVMLA
SHMDEIGLMVSFIDDDGYLRFVKIGGINDQMLLNQKVYVQTENGEVPGIIGSKPPHITSA
AEAKKIIPYKNMFIDIGAKDKEQAESLVSIGDAVVFHTEFEECLNDLVMGKALDNRVGCA
VMAEVMKQTDCDATVYGVGTVQEEVGLKGAKTSAFKLNPDMAIALDVTIAGDHPGVKPED
APVKAGKGPVISFADASGRGLLTHPMMKKLLVEAAEAADIDYQIEVGDGGTTDATAIHLT
REGIATATLSSGSRYIHTPISVVNVKDLEDTVKLILEFLKRL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtttattaaaaaaattatctgaagcttgtggaatttcaggcttcgaagatgaa
gtacgtgaaatcttaaaagatgaattaaaagatcatgttgatgatatggaaacagatatt
atgggtaatcttataacaacccataaaggtaaagaaggaaaacctagtgtaatgttagct
tcacatatggatgaaattggtcttatggtaagtttcattgatgatgatggatatttaaga
tttgttaaaattggtggaatcaacgatcaaatgttattaaatcagaaagtgtatgtacaa
acagaaaatggtgaagtacctggtattattggttccaaaccacctcatattacaagtgct
gctgaagctaaaaaaattattccatacaaaaatatgtttatagatattggagctaaagac
aaagaacaagcagaaagtcttgtttctattggagatgctgttgtattccatactgaattt
gaagaatgtttaaacgatcttgtaatgggtaaagcattagataaccgtgtaggttgtgct
gttatggcagaagtaatgaaacaaacagattgtgatgcaacagtatatggtgttggaaca
gtacaggaagaagtaggattaaaaggagctaaaacatcagcattcaagttaaatcctgat
atggctattgcattagatgtaaccattgctggagatcatcctggagtaaaacctgaagat
gctcctgtaaaagcaggaaaaggtcctgtaatatcatttgctgatgctagtggtagagga
ttattaactcatcctatgatgaaaaaattattagttgaagctgctgaagctgctgatatt
gattaccaaatagaagtaggtgatggtggaacaactgatgcaacagcaattcaccttact
cgtgaaggtatagcaactgcaactttatcaagtggttcaagatatattcacacacctatt
agtgttgtaaatgtaaaagatttagaagacacagtaaaactcatacttgaattcttaaaa
agattataa

DBGET integrated database retrieval system