KEGG   Methanosphaera stadtmanae: Msp_0588Help
Entry
Msp_0588          CDS       T00313                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mst  Methanosphaera stadtmanae
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mst00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Msp_0588 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Msp_0588 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Msp_0588 (thrC)
Enzymes [BR:mst01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Msp_0588 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
679565..680761
Genome map
AA seq 398 aa AA seqDB search
MIRCISCGKEYDDDEIIYNCTCGSILEVETEVEDIPRETFENRRDNIWKYKEFLPVNADN
RVSLDEGGTPFCKCEKIGKELGVDLYVKVEGSNPTGSFKDRGMSVGTTKAVDLGVNMVGC
ASTGNTSASLSAYAARAGLKCAVVLPSGKVALGKLAQAMFHGAKVFAIDGNFDDALKTIT
ELALDGELYLLNSINPFRLEGQKTIGFELVHDLGWESPDRVILPVGNAGNISAIWKGITE
FRDAGYIKDTPMMTGIQAVNSAPIANAVKAGEDTVTPVENPDTIATAIRIGAPVSSVKAM
RAIKESNGTAETVTDDEILDAQKYLARTEGIGVEPASAASIAGLKKLVENGDVDKGERVV
CIVTGHVLKDPNVAIDACEDPTPVSSDPNEIRNVIRTL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgatacgatgtatttcttgtggaaaagaatacgatgatgatgaaataatatataactgt
acatgtggttcaattcttgaagtagaaactgaagttgaagatattccacgtgaaactttt
gaaaatagacgagataatatctggaaatacaaagaattcttaccagtaaatgctgacaat
agagtaagtctagatgaaggtggaacaccattttgtaaatgtgaaaaaataggtaaagaa
ttaggtgtagacctttatgttaaagtagaaggttcaaatccaacaggtagttttaaagat
aggggaatgagtgtaggtacaacaaaagcagtagatcttggagtaaatatggttggttgt
gcttctacaggaaacacttcagcttcactatcagcatatgctgcacgtgctggacttaaa
tgtgcagtagtattaccatcaggaaaagtagctttaggaaaattagctcaagcaatgttc
catggagcaaaagtatttgcaattgatggaaactttgatgatgcattaaaaaccataaca
gaattagcattagatggtgaattatatcttctaaattcaataaatccattccgtttagaa
ggacaaaaaactattggatttgaattagtacatgatcttggatgggaatcaccagacaga
gtaatattacctgtaggtaatgcaggaaacatatctgcaatatggaaaggtataactgaa
tttagagatgcaggatacattaaagatactcctatgatgacaggtattcaggcagttaac
agtgcaccaatagcaaatgcagtaaaagcaggagaagacacagtaactcctgtagaaaat
ccagatactattgcaacagctataagaataggagcgcctgtaagttcagtaaaagctatg
agagcaataaaagaatctaatggtactgcagaaacagtaactgatgatgaaatattagat
gcacaaaaatatcttgcaagaacagagggtattggtgtagaaccagcatctgctgcaagt
attgcaggacttaaaaaattagttgaaaatggtgatgttgataaaggtgaacgtgttgta
tgtattgtaacaggacatgtattaaaagatcctaatgtagcaatagatgcatgtgaagat
ccaacacctgtatcatcagatcctaatgaaataagaaatgttataagaacattataa

DBGET integrated database retrieval system