KEGG   Methanosphaera stadtmanae: Msp_0675Help
Entry
Msp_0675          CDS       T00313                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
mst  Methanosphaera stadtmanae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mst00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Msp_0675
   01230 Biosynthesis of amino acids
    Msp_0675
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Msp_0675
   00030 Pentose phosphate pathway
    Msp_0675
   00051 Fructose and mannose metabolism
    Msp_0675
  Energy metabolism
   00680 Methane metabolism
    Msp_0675
Enzymes [BR:mst01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Msp_0675
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Msp_0675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
785707..786801
Genome map
AA seq 364 aa AA seqDB search
MKTTVSIIKADIGSVGGHAVTHQKLKDKCNEYLSNAKEEGLLTDFYITNCGDDIDMIMTH
TNGTDNEEVHKLAFDTFMAGAEVAKGLKLYGAGQDLLSDTFSGNIKGMGPGSAEMEFKER
GSDPVFAYCCDKTEPGAFNLPLFRMFADPFNTAGLVIDPSLHGGFDFEVYDVIENRKVVM
SCPDEMYDLLALIGSTGRYVIKRIFRRSDNEIAAAVSTDKLNLMAGKYIGKDDPVAIVRS
QSGFPAGGETSEPFAFPHLVSGWMRGSHNGPLMPVSQADARPVRFDGPPRVIGLGFQVSE
AKLIGPVDMFADPAFDDARNTATKVANYMRRHGPFEPHRLPADEMEYTSLPGVLEKLEDR
FEDM
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaactgtaagtataattaaagcagatattggtagtgttggtggacacgcagta
acacaccaaaaattaaaagataaatgtaacgaatacttatccaatgcaaaagaagaagga
ttattaactgatttttatataaccaattgtggtgacgatatagatatgatcatgactcac
acaaacggtaccgataacgaagaagtacacaaattagcatttgatacttttatggctgga
gcagaagttgcaaaaggacttaaattatacggtgcaggtcaagatttattatctgataca
tttagtggaaacataaaaggtatgggtccaggtagtgcagaaatggaatttaaagaaaga
ggttctgatcctgtatttgcatattgttgtgacaaaacagaaccaggagcatttaactta
ccattatttagaatgtttgcagacccattcaacactgcaggattagtaattgacccatca
ttacatggtggatttgactttgaagtttatgatgtaatagaaaatagaaaagttgtaatg
tcctgtcctgatgaaatgtatgatttattagcattaattggttcaactggaagatacgta
ataaaaagaatcttcagaagatctgataatgaaatagcagcagcagtaagtacagataaa
ttaaacttaatggctggaaaatacataggaaaagatgacccagttgcaatagtaagatca
caatcaggattccctgcaggtggagaaacttccgaacctttcgcattccctcacttagta
agtggatggatgagaggatcacataacggacctttaatgccagtatcccaagcagatgca
agacctgtaagatttgacggacctcctcgtgtaataggactcggtttccaagtaagtgaa
gcaaaattaattggtcctgtagatatgtttgcagatccagcatttgatgatgcaagaaac
acagcaacaaaagttgcaaattacatgagaagacatggaccatttgaacctcacagatta
cctgcagatgaaatggaatacacaagtcttccaggcgtacttgaaaaactcgaagataga
tttgaagatatgtaa

DBGET integrated database retrieval system