KEGG   Methanosphaera stadtmanae: Msp_1072Help
Entry
Msp_1072          CDS       T00313                                 

Gene name
trpC
Definition
hypothetical protein
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mst  Methanosphaera stadtmanae
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mst01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:mst00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1212361..1213152
Genome map
AA seq 263 aa AA seqDB search
MNVIDRIIENKKVTLTQTKKQKPLEKLKEEAIDIVSTKTKLFRFQEKLKNKTTQLIAEYK
PASPSKGNISTLKAEDVIPIYDKNNVDMMSILTEETYFKSNLKNFNIANNLTNKPLLRKD
FIIDEYMIYEAAVNNASGILLISGICPNIEEYLNISRNLGLDAVVECHTLEDIESVVDYN
PEIIGINNRNLDDFTINLKTTKELKKYVPNYLISESGVKTIEDAKKLKEYGADGILIGTS
ILQNNTEKEIEKFIENLINVLKK
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaatgttatagatagaataatagaaaataaaaaagtaacactcacacaaactaaaaaa
caaaaacccctagaaaaacttaaagaagaggcaattgacatagtttctacaaaaacaaag
ttatttagatttcaagaaaaactaaaaaataaaacaacacaactcattgcagaatacaaa
cctgcaagtccatcaaaaggaaatatcagtacattaaaagcagaagatgttattccaata
tatgataaaaataacgtagacatgatgtcaattttaactgaagaaacatactttaaaagt
aatctaaaaaattttaacatagcaaacaacttaacaaacaaaccattacttagaaaagat
tttattatagatgaatacatgatctatgaagctgctgttaataatgctagtggaatatta
ttaataagtggaatctgtcctaatatagaagaatatttgaatatttctagaaatcttgga
ttagatgcagtagttgaatgtcatacattagaggatattgaatctgtagtagattataac
cctgaaattattggtataaacaatagaaatctagatgattttactattaatcttaaaaca
acaaaagaattaaaaaaatatgttccaaactacttaatatcagaaagtggagtaaaaacc
atagaagatgctaaaaaattaaaggaatatggagcagatggtattttaataggaacaagt
atcctacaaaacaacacagaaaaagaaattgaaaaatttattgaaaacctaattaacgtc
ctaaaaaaataa

DBGET integrated database retrieval system