KEGG   Methanosphaera stadtmanae: Msp_1074Help
Entry
Msp_1074          CDS       T00313                                 

Gene name
trpB
Definition
(GenBank) TrpB (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mst  Methanosphaera stadtmanae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mst00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Msp_1074 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Msp_1074 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Msp_1074 (trpB)
Enzymes [BR:mst01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Msp_1074 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1213857..1215038
Genome map
AA seq 393 aa AA seqDB search
MKYEGKFGKYGGIFVPELLIPAIEELEEAFYKFKDDEEFMNELHFYLKEFASRPTGLYYA
ENLSNELGCKIYLKREDLLHTGAHKINNAIGQGLLAKYMGKTELIAETGAGQHGIATAVI
GAKLGLKVKIFMGSKDVERQKLNVFRMELSGAEVIPVDMGSKTLKDSINEAFRYWISNLD
TSHYLIGTTMGPHPYPSMVKFFQSVIGKEAREQILEKENKLPDTVIACVGGGSNSIGIFS
GFVDDEDVDLIGVEAAGDGIDTNEHGATLTKGTEGILHGSLSIVLQDEDGQINDTSSVSA
GLDYPGVGPEHAYLQSSGRAKYVPITDKEALNAFRLLCETEGIIPALESSHAVAYAVKYA
KQEENKGKTIIVNLSGRGDKDMFTVAKELGVSI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatgaaggaaaatttggaaaatatggtggtatctttgtaccagaattattaata
cctgcaattgaagaattagaagaagcattctacaaattcaaagatgatgaagaatttatg
aatgaattacatttttatcttaaagaatttgcttctagacctacaggcctatattatgca
gaaaatctttcaaatgaattgggatgtaaaatatatcttaaaagagaagatttactccac
actggtgctcataaaataaacaatgctattggacaaggattactagcaaagtacatgggt
aaaaccgaattaatagcagaaactggtgctggacaacatggaattgcaactgcagtaatt
ggagctaaattaggattgaaagtaaaaatattcatgggatctaaggatgttgaacgtcaa
aaactaaatgtattccgtatggaattatcaggagccgaagtaattcctgttgatatggga
tctaaaaccttaaaagattcaattaatgaagctttcagatactggatttccaaccttgat
actagtcattatctgattggaacaacaatgggaccacatccatatccttcaatggtgaaa
tttttccaaagtgttataggaaaagaagcacgtgaacaaatacttgaaaaagaaaataaa
cttccagatactgttatagcatgtgttggtggaggaagtaattccataggtatttttagt
ggatttgttgatgatgaagatgtggatcttattggtgttgaagcagcaggtgatggaata
gataccaatgaacatggagctactttaactaagggaactgaaggtatacttcatggatca
ttatctattgtattacaagatgaagatggacaaattaatgatacaagtagtgtttctgca
ggtttagactatcctggagttggaccagaacatgcttatttacaaagtagtggtagagca
aaatatgttcctattacagataaagaagctttaaatgcctttagattattatgtgaaact
gaaggaattatacctgcattagaaagttcacatgcagtagcatatgctgttaaatatgca
aaacaagaagaaaataaaggaaaaactatcattgtaaacttatcaggtcgtggagataag
gatatgtttactgtagcaaaagaattaggggtatcaatatga

DBGET integrated database retrieval system