KEGG   Methanosphaera stadtmanae: Msp_1075Help
Entry
Msp_1075          CDS       T00313                                 

Gene name
trpA
Definition
(GenBank) TrpA (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mst  Methanosphaera stadtmanae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mst00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Msp_1075 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Msp_1075 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Msp_1075 (trpA)
Enzymes [BR:mst01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Msp_1075 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1215035..1215844
Genome map
AA seq 269 aa AA seqDB search
MSMKTYTEVFKKSKENNEGIFIPFLVAGDPDYDTSLEIAKTLVDNGADALEIGFPFSDPV
ADGKSVQNADIRAFNSGMNIKKCIKFLKQLREYTDKPFGLLLYYNLVYNYGIDAFYKKLS
EIGVNAVLIADLPPEEADDVIEASNKYNIEEIFIVSQATNNDRLKMITEIVGGFIYVASV
MGTTGARSNVEHNTTDLIKRIRKHTDIPLCVGFGISQPEHVKEVLDAGADGAIVGSALIN
IIEDNLDNEDVMFGCIAEYIQSMKDATKR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagtatgaaaacatatacagaagtttttaaaaaatctaaggaaaataatgaaggaata
ttcataccatttctagtggcaggagatcctgactatgacacatcgttagaaattgctaaa
acattggttgataatggtgcagatgctcttgaaatcggttttccattttcagatccagta
gctgatggaaaaagtgttcaaaatgcagacattcgtgcatttaacagtggtatgaacatt
aaaaaatgtattaaattcctaaaacaattacgtgaatatactgataaaccatttggttta
ctattatattataatctagtttataattatggaattgatgcattttataagaaattaagt
gaaattggagttaatgccgtattaattgcagatttaccacctgaagaagcagatgatgta
attgaagcttctaacaaatataatatagaagaaattttcattgtatcacaagcaacaaac
aatgatagattaaaaatgattacagaaattgttggtggatttatctatgttgcatcagtt
atgggaacaactggtgctagatcaaatgtggaacataatactacagatttaataaaaaga
attcgtaaacacacagatattccattatgtgtaggatttggtatttcacaaccagaacat
gtaaaagaagtgttagacgctggtgcagatggtgctattgttggtagtgcattgattaat
attattgaagataacttagataatgaagatgttatgtttggatgtatagctgaatatata
caaagtatgaaagatgctacaaaaaggtaa

DBGET integrated database retrieval system