KEGG   Methanosphaera stadtmanae: Msp_1101Help
Entry
Msp_1101          CDS       T00313                                 

Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mst  Methanosphaera stadtmanae
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:mst00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mst00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mst00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mst00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1249372..1250223)
Genome map
AA seq 283 aa AA seqDB search
MKAIIPAAGLGTRFLPATKAQPKEMLPVFNKPTIQYVVEEAVNSGIDDILIITGKGKRTI
EDHFDRSFELEYSLNEKGKYDYLQEVQEITDMADIYYVRQKKQNGLGDAISCAEKHIGGD
AFAVLLGDTITYSQTPCTKQLLDVYEKYGGSTIAIEELPESKIERYGIVDGHHLSDNIYK
VDSLVEKPKLEEAPSNLGITGRYILTSDIFDKLRTIEAGVGGEIQLTDAINEQDDVYATT
FEGTIYDIGNTMEWLKSSIDMALTHEDVRLELLQHMKQKINQY
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcaataataccagcagcaggtttaggaacaaggtttttaccagcaacaaaagct
cagccaaaagaaatgttacctgtatttaataaaccaacaatacagtatgttgtagaagaa
gcagtaaattctggaattgatgatattctaattataacaggtaaagggaaacgtacaatt
gaagaccattttgatagatcatttgaattagaatatagtttaaatgaaaagggaaaatat
gattatttacaggaagttcaagaaattacagacatggctgatatatattatgttagacag
aaaaaacagaatggtttaggtgatgcaatttcttgtgcagaaaaacatataggtggtgat
gcatttgcagtacttcttggagatacaataacctactctcaaactccatgtacaaaacaa
ttattagatgtatatgaaaaatatggtggttctacaatagcaattgaagaattaccagag
agtaaaattgaaagatatggaattgttgatggtcatcatttaagtgataatatatataag
gtagatagtcttgttgaaaaacctaaattagaagaagctccatcaaatcttggtataact
ggtagatatatattaacatcagatatttttgataaattaagaactattgaagctggtgtt
ggtggagaaattcagttaacagatgcaataaatgaacaagatgatgtttatgcaacaaca
tttgaaggtacaatctatgatataggaaatactatggaatggttaaaaagttcaatagat
atggctctaacacatgaagatgtacgtttagaactgttacaacacatgaaacaaaagatt
aatcaatactaa

DBGET integrated database retrieval system