KEGG   Methanosphaera stadtmanae: Msp_1101Help
Entry
Msp_1101          CDS       T00313                                 

Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mst  Methanosphaera stadtmanae
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mst00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Msp_1101
   00052 Galactose metabolism
    Msp_1101
   00500 Starch and sucrose metabolism
    Msp_1101
   00520 Amino sugar and nucleotide sugar metabolism
    Msp_1101
Enzymes [BR:mst01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Msp_1101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1249372..1250223)
Genome map
AA seq 283 aa AA seqDB search
MKAIIPAAGLGTRFLPATKAQPKEMLPVFNKPTIQYVVEEAVNSGIDDILIITGKGKRTI
EDHFDRSFELEYSLNEKGKYDYLQEVQEITDMADIYYVRQKKQNGLGDAISCAEKHIGGD
AFAVLLGDTITYSQTPCTKQLLDVYEKYGGSTIAIEELPESKIERYGIVDGHHLSDNIYK
VDSLVEKPKLEEAPSNLGITGRYILTSDIFDKLRTIEAGVGGEIQLTDAINEQDDVYATT
FEGTIYDIGNTMEWLKSSIDMALTHEDVRLELLQHMKQKINQY
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcaataataccagcagcaggtttaggaacaaggtttttaccagcaacaaaagct
cagccaaaagaaatgttacctgtatttaataaaccaacaatacagtatgttgtagaagaa
gcagtaaattctggaattgatgatattctaattataacaggtaaagggaaacgtacaatt
gaagaccattttgatagatcatttgaattagaatatagtttaaatgaaaagggaaaatat
gattatttacaggaagttcaagaaattacagacatggctgatatatattatgttagacag
aaaaaacagaatggtttaggtgatgcaatttcttgtgcagaaaaacatataggtggtgat
gcatttgcagtacttcttggagatacaataacctactctcaaactccatgtacaaaacaa
ttattagatgtatatgaaaaatatggtggttctacaatagcaattgaagaattaccagag
agtaaaattgaaagatatggaattgttgatggtcatcatttaagtgataatatatataag
gtagatagtcttgttgaaaaacctaaattagaagaagctccatcaaatcttggtataact
ggtagatatatattaacatcagatatttttgataaattaagaactattgaagctggtgtt
ggtggagaaattcagttaacagatgcaataaatgaacaagatgatgtttatgcaacaaca
tttgaaggtacaatctatgatataggaaatactatggaatggttaaaaagttcaatagat
atggctctaacacatgaagatgtacgtttagaactgttacaacacatgaaacaaaagatt
aatcaatactaa

DBGET integrated database retrieval system