KEGG   Methanosphaera stadtmanae: Msp_1382Help
Entry
Msp_1382          CDS       T00313                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mst  Methanosphaera stadtmanae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mst00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Msp_1382 (tpiA)
   01230 Biosynthesis of amino acids
    Msp_1382 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Msp_1382 (tpiA)
   00051 Fructose and mannose metabolism
    Msp_1382 (tpiA)
   00562 Inositol phosphate metabolism
    Msp_1382 (tpiA)
Enzymes [BR:mst01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Msp_1382 (tpiA)
Exosome [BR:mst04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Msp_1382 (tpiA)
  Exosomal proteins of bladder cancer cells
   Msp_1382 (tpiA)
  Exosomal proteins of melanoma cells
   Msp_1382 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1552205..1552882)
Genome map
AA seq 225 aa AA seqDB search
MSKNKTPIIILNYKTYTESTGKNAVKLSQYVQEASDETGINMAIAPQAVDLYPIIESVDI
PVYAQHMDAITPGGHTGSALPEALYETGIEGSLINHSEKRLTLADIDVVVEKTRQLDLTS
VLCTNNVKTSAACASFNPDFIAIEPPELIGTGIPVSQASPEVVENTVEEIHKINKNISVL
CGAGISTGEDMKAALDLGAQGVLLASGIIKAENQKEALIDLVSLI
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagaataagacaccaataataatacttaattataaaacatatacagaatcaaca
ggtaaaaatgcagtaaaattatcacagtatgttcaagaagcaagtgatgaaacaggtata
aatatggcaattgctccacaagcagttgatttatatccaattattgaatctgtggatatt
cctgtttatgctcaacacatggatgctataactcctggaggacatacaggttcagcttta
cctgaagctttatatgaaactggtatagagggtagtttaattaatcattcagagaaaaga
ttaactttggctgatattgatgttgttgttgaaaaaacaagacaactagatttaactagt
gtattatgtactaataatgttaaaacaagtgctgcctgtgcatcatttaatccagatttc
attgcaattgaaccacctgaattaattggtactggtattcctgtctctcaagctagtcct
gaagtagttgaaaatacagttgaagaaattcataaaattaacaagaatatatcagtatta
tgtggtgctggaatatctacgggagaagatatgaaagcagcattagatcttggtgctcaa
ggagttctactagcttctggtattattaaagcagaaaatcaaaaagaagctctaattgat
ttagttagtttaatttaa

DBGET integrated database retrieval system