KEGG   Mannheimia succiniciproducens: MS0004Help
Entry
MS0004            CDS       T00201                                 

Gene name
pldB
Definition
PldB protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
msu  Mannheimia succiniciproducens
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:msu00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5202..6152)
Genome map
AA seq 316 aa AA seqDB search
MLNREPKFSNFALTELLPFAERCPLNYIKGKNNIKIAYRHFKHEHDGNDRLLVLVNGRAE
NLLKWTEVAYDFYRQGYDVLSFDHRGQGYSDRLLKNRDKGYIDEFRYYTDDMAAVIAEAY
SYRQYSSCHLVAHSLGALISTYYLANYDHHIKSAVLSAPFYGLQLRRPFIDQIIINLMIL
FGQGKRYVPGKEGYKPANLNNNDLSFCKTRMKWMNRINRNHPAIHLGGPTFRWVHLCLNA
IKGLPKIIPRIEIPILILHSDKEKIVNNKNLQKLTALFQHVQVEEIQNAKHEILFERDAL
RARAIQRISKFFTDFK
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgctaaacagagaacctaaatttagcaattttgcattaaccgaactgcttccctttgcg
gaacgctgtccgctaaattatatcaagggcaaaaacaacataaaaatcgcttatcgccat
tttaaacatgaacatgacggtaatgacaggttattggtgttagtaaacggacgtgcggaa
aatttgctgaaatggactgaagtggcttatgatttttatcgccagggttatgatgtgctg
agtttcgatcatcgagggcaaggttattccgatcggctattaaaaaatagagataaaggt
tacattgatgaattccgctattatacggacgatatggcggcggttatcgctgaggcttat
tcctatcgtcaatacagctcctgccacctagtggctcattcattaggggcgttaatcagc
acctattatcttgctaactatgatcaccatataaaaagtgccgtgttatccgcacctttt
tacggtttacagttacgtcgcccgtttatcgatcaaattatcattaatttgatgatacta
ttcggacaaggaaaacgttatgtaccgggaaaagaaggctataagccggctaatttaaac
aataacgatctcagtttctgcaaaacccgcatgaaatggatgaacagaattaatcgcaat
catccggcaattcatcttggcggaccgacattccgttgggttcatttatgcttaaacgcg
ataaaaggtctgcctaaaattattccccgcattgaaatacctattttaattttgcattcc
gataaagagaaaatcgtaaataacaaaaatctacaaaaattaaccgcactttttcaacat
gttcaagtggaagaaatacaaaatgcaaaacatgaaattctgtttgagcgtgatgcatta
agggctcgggcgattcaacgaatcagtaaatttttcacggacttcaaataa

DBGET integrated database retrieval system