KEGG   Mannheimia succiniciproducens: MS0004Help
Entry
MS0004            CDS       T00201                                 

Gene name
pldB
Definition
(GenBank) PldB protein
  KO
K01048  lysophospholipase [EC:3.1.1.5]
Organism
msu  Mannheimia succiniciproducens
Pathway
msu00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:msu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    MS0004 (pldB)
Enzymes [BR:msu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     MS0004 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 LCAT Ser_hydrolase PDDEXK_9 DUF676
Motif
Other DBs
NCBI-ProteinID: AAU36611
UniProt: Q65WP9
Position
complement(5202..6152)
Genome map
AA seq 316 aa AA seqDB search
MLNREPKFSNFALTELLPFAERCPLNYIKGKNNIKIAYRHFKHEHDGNDRLLVLVNGRAE
NLLKWTEVAYDFYRQGYDVLSFDHRGQGYSDRLLKNRDKGYIDEFRYYTDDMAAVIAEAY
SYRQYSSCHLVAHSLGALISTYYLANYDHHIKSAVLSAPFYGLQLRRPFIDQIIINLMIL
FGQGKRYVPGKEGYKPANLNNNDLSFCKTRMKWMNRINRNHPAIHLGGPTFRWVHLCLNA
IKGLPKIIPRIEIPILILHSDKEKIVNNKNLQKLTALFQHVQVEEIQNAKHEILFERDAL
RARAIQRISKFFTDFK
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgctaaacagagaacctaaatttagcaattttgcattaaccgaactgcttccctttgcg
gaacgctgtccgctaaattatatcaagggcaaaaacaacataaaaatcgcttatcgccat
tttaaacatgaacatgacggtaatgacaggttattggtgttagtaaacggacgtgcggaa
aatttgctgaaatggactgaagtggcttatgatttttatcgccagggttatgatgtgctg
agtttcgatcatcgagggcaaggttattccgatcggctattaaaaaatagagataaaggt
tacattgatgaattccgctattatacggacgatatggcggcggttatcgctgaggcttat
tcctatcgtcaatacagctcctgccacctagtggctcattcattaggggcgttaatcagc
acctattatcttgctaactatgatcaccatataaaaagtgccgtgttatccgcacctttt
tacggtttacagttacgtcgcccgtttatcgatcaaattatcattaatttgatgatacta
ttcggacaaggaaaacgttatgtaccgggaaaagaaggctataagccggctaatttaaac
aataacgatctcagtttctgcaaaacccgcatgaaatggatgaacagaattaatcgcaat
catccggcaattcatcttggcggaccgacattccgttgggttcatttatgcttaaacgcg
ataaaaggtctgcctaaaattattccccgcattgaaatacctattttaattttgcattcc
gataaagagaaaatcgtaaataacaaaaatctacaaaaattaaccgcactttttcaacat
gttcaagtggaagaaatacaaaatgcaaaacatgaaattctgtttgagcgtgatgcatta
agggctcgggcgattcaacgaatcagtaaatttttcacggacttcaaataa

DBGET integrated database retrieval system