KEGG   Mannheimia succiniciproducens: MS0196Help
Entry
MS0196            CDS       T00201                                 

Gene name
gdhA
Definition
glutamate dehydrogenase (EC:1.4.1.4)
Orthology
K00262  
glutamate dehydrogenase (NADP+) [EC:1.4.1.4]
Organism
msu  Mannheimia succiniciproducens
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Nitrogen metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:msu00910]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:msu00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:msu00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
169634..171022
Genome map
AA seq 462 aa AA seqDB search
MQTLTILLIRGKLMSSTVSSLEDFLSLVAQRDGNQPEFLQAVREVFTSIWPFLEANPQYR
SQALLERLVEPERAFQFRVAWTDDKGQVQVNRAFRVQFSSAIGPYKGGMRFHPSVNLSIL
KFLGFEQIFKNALTTLPMGGGKGGSDFDPKGKSDAEVMRFCQALVAELYRHIGPDTDVPA
GDIGVGGREVGYLAGYMKKLSNQAACVFTGRGLSFGGSLIRPEATGYGLVYFAQAMLAEK
GDSFQGKTVSVSGSGNVAQYAIEKALQLGAKVVTCSDSAGYVYDEAGFTTEKLAALLDIK
NVKRGRVKDYAEQFGLQYFPGERPWGVKVDIALPCATQNELELTDAQKLIANGVQLVAEG
ANMPTTIEATEALQAAGVLFAPGKAANAGGVATSGLEMAQSSQRLFWSAEEVDQKLHNIM
LDIHANCKKYGTDANGNINYVAGANIAGFVKVADAMLAQGVY
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaacattaacaatattactaataagaggaaagcttatgtccagcacagtatcatct
ctagaagactttttatcattagttgcacaacgtgacggtaaccaacctgaattcctgcag
gcggtgcgtgaagtgtttacttctatttggccgtttttggaagcaaatccgcaatatcgt
tcacaagcattattagaacgtttggttgaacctgagcgtgcattccaattccgtgtggct
tggacagacgataaaggtcaagtgcaggtaaaccgcgcatttcgcgttcagttcagtagt
gctatcggtccgtacaaaggcggtatgcgtttccacccgtcagtgaacttatctatctta
aaattcttaggttttgaacaaatttttaaaaatgccttaacaaccttgccgatgggcggt
ggtaaaggcggttcggatttcgatccgaaaggtaaatccgatgcggaagttatgcgtttc
tgtcaggcgttggtagccgaattatatcgccatatcggtccggatacagacgtgccggca
ggcgacatcggtgttggcggtcgtgaagtgggttatcttgccggctacatgaaaaaatta
tctaaccaggccgcttgcgtattcaccggacgcggtctgtcattcggcggcagcttaatc
cgtccggaagcgacaggttacggcttagtttactttgctcaagcaatgttggcggaaaaa
ggtgatagtttccaaggtaaaaccgtttctgtatccggttccggtaacgttgcccaatac
gccatcgaaaaggctcttcaattaggtgcgaaagtagtaacctgttcggacagtgccggt
tatgtgtatgatgaagcgggtttcaccactgaaaaattagcggcattattagacatcaag
aatgtaaaacgcggtcgtgtgaaagattacgcagaacaattcggcttgcaatacttcccg
ggcgaacgtccgtggggtgtgaaagtggatatcgctttaccatgtgcaacccaaaacgaa
ttggaacttaccgatgcgcaaaaattaattgccaacggcgtgcaattggtagcggaaggt
gcaaatatgccgacaactattgaagcgaccgaagcattacaggcggcaggcgtattattt
gcgccgggtaaagcggcaaatgccggcggtgtagcaacttcaggccttgaaatggcacag
agttcgcaacgtttattctggagcgcggaagaagtggatcaaaaattacacaatattatg
ttagatattcatgcgaactgcaaaaaatacggtacggatgcaaacggcaatattaactac
gtagcgggcgccaacatcgcaggtttcgtgaaagtagcggatgcaatgcttgcgcaaggc
gtatattaa

DBGET integrated database retrieval system