KEGG   Mannheimia succiniciproducens: MS0223Help
Entry
MS0223            CDS       T00201                                 

Gene name
mauG
Definition
MauG protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
msu  Mannheimia succiniciproducens
Brite
Enzymes [BR:msu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     MS0223 (mauG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
199568..200971
Genome map
AA seq 467 aa AA seqDB search
MKKYFLSAIAIAGLGYLSMVGYAHFFDKSQSEKLYAATEVPQQFKPVAKVMFDNGCQYCH
SPSADIPGYANFPIAKQLMEQDIAQGLRSFRLDRMFEGMKDPSKLSEADLAKLEQVIRND
QMPAAKFLHIHWGTRPDADEKQVLLDWIKQQREAHFLPQNTQGADAARLVQPIPDAIATD
PHKVALGEKLYFDGRLSADGSIQCHTCHQLEQAGVDNLPVSEGIEGKKGGINAPTVFNAA
FNKWQFWDGRAKTLADQAGGPPINPVEMGSKDWDEIIARLDQDEAFKKEFLSVFPELSQA
TVTEAIGEFEKTLITPNSAFDRYLKGEQSALNDQQKRGYELFKNAKCDTCHTGTAMGGQS
FEYMGIYDDYFKARGTDLTDADKGRFAETQDPYDMHRFKVPTLRNVALTAPYMHDATAKD
LKEAVRIMGHYQSNKDFSDAELDDIVSFLNSLTGEFKGKLLTNEKMK
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatattttttatccgccatagcgatcgccggtttgggctatttatcaatggta
ggctacgcccacttttttgataaatcccaatcggaaaaactgtatgccgcaacggaggtt
ccgcaacaattcaaaccggttgccaaagtgatgtttgacaacggttgtcaatattgccat
tcgccgagtgccgatattcccggttacgcgaatttcccgattgccaaacagttaatggag
caagatattgcccaaggtttgcgcagtttccgtttggatcggatgtttgaaggcatgaag
gacccaagcaaactttccgaagcggatttggctaaattggaacaggttattcgtaatgat
cagatgcctgcggcgaaatttttacatattcactggggcactcgtcccgatgcggatgaa
aaacaagtcttgttagactggattaaacaacaacgtgaagcgcatttcctacctcaaaac
acccagggtgcggatgccgcacgtttagtacaacctattcctgatgcgattgcaacggat
cctcacaaagtcgccttgggcgagaaattgtattttgacgggcgcttatccgccgacggt
tcgattcaatgccatacctgtcaccagcttgagcaggcgggggtagataatttaccggta
tccgaagggattgaaggtaaaaaaggcggcattaacgcaccgacggtctttaatgcggca
tttaacaaatggcaattctgggacggtcgtgcgaagacattagcggatcaagcgggcgga
ccgcccattaatccggtagaaatgggttcaaaagattgggatgaaattattgcccgtctg
gatcaagacgaggcattcaaaaaagaattcttatcggttttcccggaactttcacaagca
accgtcaccgaagctatcggcgagtttgaaaaaacattaattacgccgaacagtgctttt
gaccgctatttgaaaggtgaacaatccgccttaaacgatcagcaaaagcgcggttatgaa
ttatttaaaaatgccaaatgcgacacctgtcataccggtaccgcaatgggcggacaatcc
ttcgaatacatgggtatttatgacgattacttcaaagcccgcggtacggatttaacggat
gcggataaaggacgtttcgccgaaacccaagatccttacgatatgcatcgtttcaaagta
ccgactttgcgtaatgtggcgttgaccgcaccttatatgcacgacgcaacggcgaaagac
ctgaaagaagcggttcgcattatgggacattatcaaagcaataaagatttctctgacgca
gaactcgacgatatcgtttctttcttaaattcattaactggtgaatttaaagggaaatta
ttaaccaacgagaaaatgaaataa

DBGET integrated database retrieval system