KEGG   Mannheimia succiniciproducens: MS0283Help
Entry
MS0283            CDS       T00201                                 

Gene name
rbsK
Definition
(GenBank) RbsK protein
  KO
K00852  
ribokinase [EC:2.7.1.15]
Organism
msu  Mannheimia succiniciproducens
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MS0283 (rbsK)
Enzymes [BR:msu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     MS0283 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
259689..260621
Genome map
AA seq 310 aa AA seqDB search
MDKIMKKLTVLGSINADHVISVPHFVKPGETLTGSNYHIAYGGKGANQAVAAARLGADVD
FIACIGDDDIGKAMKAAFERDGIHTHTISTIPHQTTGIAMIQVAESGENSIVISAGANAH
LTEELLAQHQESIAHADCLLMQLETPISAVEKAAVFAKRNGTKVVLNPAPAQPLSDHLLA
HIDMITPNETEAEILTGVQVTDEQSAAEAAQVFHHKGIETVLITLGSKGVFFSSRGVQRI
IPGFRVKAVDTTAAGDTFNGALITALLEDKSMEEAIRFAHGAAAISVTRKGAQPSIPSRE
ETLAFLNEQH
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
ttggataaaattatgaaaaagctaactgttctcggtagtattaatgcagatcatgtgatt
tccgtaccgcactttgtgaaacccggtgaaaccctgaccggttcgaattatcatattgct
tatggcgggaaaggggcaaatcaagcggttgccgccgcacgattgggggctgatgtggat
tttatcgcctgtataggtgatgacgatatcggtaaagccatgaaagccgcttttgaacgg
gacggtatccatacccatacgatttccactattcctcatcaaactaccgggatcgcaatg
attcaagtagcggaaagcggggagaatagcatcgtgatttcggcgggagcgaatgcgcat
ttaaccgaagaactgttagctcaacatcaagagagtattgcacatgcggactgcctgctt
atgcagttggaaacgcctataagtgcggtagaaaaagcggcggtttttgctaaacggaac
gggacaaaagttgtactcaatcccgcaccggcgcagcctttgtccgatcatttacttgcc
catatcgatatgattacgccgaatgaaaccgaagcggaaattctcaccggcgtgcaagta
acggatgaacaaagtgcggcggaagcagcgcaggtttttcatcacaaaggtattgaaacg
gtgctgattacgctgggatcaaaaggcgtatttttcagcagccggggcgttcaacggatt
attccggggtttcgggtaaaagccgttgataccacggcggcgggcgatacctttaacggt
gcattgattaccgcgttgctggaggataaatccatggaggaagctatccgttttgctcac
ggtgcggcggctatcagcgttacccgcaaaggggcgcaaccttcaattccaagtagagaa
gaaacattagcctttcttaatgaacaacattaa

DBGET integrated database retrieval system