KEGG   Mannheimia succiniciproducens: MS0324Help
Entry
MS0324            CDS       T00201                                 

Gene name
tpiA
Definition
(GenBank) TpiA protein
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
msu  Mannheimia succiniciproducens
Pathway
msu00010  Glycolysis / Gluconeogenesis
msu00051  Fructose and mannose metabolism
msu00562  Inositol phosphate metabolism
msu01100  Metabolic pathways
msu01110  Biosynthesis of secondary metabolites
msu01120  Microbial metabolism in diverse environments
msu01130  Biosynthesis of antibiotics
msu01200  Carbon metabolism
msu01230  Biosynthesis of amino acids
Module
msu_M00002  Glycolysis, core module involving three-carbon compounds
msu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:msu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MS0324 (tpiA)
   00051 Fructose and mannose metabolism
    MS0324 (tpiA)
   00562 Inositol phosphate metabolism
    MS0324 (tpiA)
Enzymes [BR:msu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MS0324 (tpiA)
Exosome [BR:msu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MS0324 (tpiA)
  Exosomal proteins of bladder cancer cells
   MS0324 (tpiA)
  Exosomal proteins of melanoma cells
   MS0324 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AAU36931
UniProt: Q65VS9
Position
300566..301333
Genome map
AA seq 255 aa AA seqDB search
MARRPLVMGNWKLNGSKAFTKELIEGLKAELAGVEGCDVAIAPPVMYLAEAEAALAGSKI
VLGSQNVDVNVKGAFTGDISTEMLKDFGAKYIIIGHSERRTYHKESDEFVAQKFGALKEA
GLTPVLCIGESEAENEAGKTEEVCARQIDAVINALGVEAFNGAVIAYEPIWAIGTGKSAT
PAQAQAVHAFIRGHIAAKSQAVADQVIIQYGGSVNDANAAELFTQPDIDGALVGGASLKA
PAFAVIVKAAAKAKA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtcgtcctttagttatgggtaactggaaattaaacggtagcaaagcgtttact
aaagaattaatcgaaggcttaaaagccgaattagcgggcgttgaaggttgtgatgtggcg
atcgctccgccggtaatgtatcttgcggaagcggaagccgcacttgcaggcagtaaaatc
gtattaggttcacaaaacgttgatgtgaatgtcaaaggcgccttcaccggcgatatttca
accgaaatgttaaaagatttcggtgcgaaatatattattatcggccactccgaacgtcgc
acataccataaagaaagcgatgaatttgttgcacaaaaattcggtgcgttaaaagaagcg
ggtttaacccctgtattatgtatcggtgaaagtgaagcggaaaacgaagcgggtaaaacc
gaagaagtttgcgcgcgtcaaatcgatgcggtaatcaatgccttaggcgttgaagctttc
aacggtgcggttatcgcttatgaaccgatttgggcaatcggtaccggcaaatctgccact
cctgcacaggcacaagcggttcacgcgtttatccgcggccatatcgctgcaaaatcacaa
gcggttgcggatcaggtcattatccaatacggcggttccgtaaatgatgccaatgctgcg
gaattattcactcaaccggatatcgacggtgcgttagtgggcggtgcttcattaaaagcg
cctgcatttgcggtaatcgttaaagcggcggcaaaagcaaaagcttaa

DBGET integrated database retrieval system