KEGG   Mannheimia succiniciproducens: MS0345Help
Entry
MS0345            CDS       T00201                                 

Gene name
galU
Definition
GalU protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
msu  Mannheimia succiniciproducens
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:msu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MS0345 (galU)
   00052 Galactose metabolism
    MS0345 (galU)
   00500 Starch and sucrose metabolism
    MS0345 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    MS0345 (galU)
Enzymes [BR:msu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MS0345 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(322746..323648)
Genome map
AA seq 300 aa AA seqDB search
MKGKTMKVIIPVAGLGTRMLPATKAIPKEMLTLVDKPLIQYVVNECIAAGVKEIVLVTHS
SKNAIENHFDTSFELETMLEKRVKRQLLEEVRSICPKDVTIMHVRQGNAKGLGHAVLCGR
PAVGNEPFAVVLPDVLLAEFTANQKTENLSAMIKRFNETGSSQIMVAPVDPKDVSSYGIA
DCNGAEFSGGESAVISRMVEKPSPEKAPSNLAVVGRYVFSATIWDLLERTPVGVGDEIQL
TDAIDMLIAKETVEAFHMTGESFDCGDKIGYMKAFVEYGIQHEKLGNEFKNYLKAFAKTL
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaggaaaaaccatgaaagttattatcccggtagccggtctgggtacgcgtatgtta
cctgcgacaaaagccattcctaaagaaatgttgactttagtcgataaacctttaatccaa
tatgtggttaacgaatgcattgcggcgggcgttaaagaaatcgtgttagttacccattcg
tcgaaaaatgctatcgaaaaccattttgacacttcatttgaactggaaaccatgctggaa
aaacgcgttaaacgtcagttgcttgaagaagtgcgttctatttgcccgaaagacgtcacc
attatgcacgtacgtcaaggtaatgcaaaaggtttaggccatgccgttttatgcggccgc
cctgccgtgggtaacgagccttttgccgtagtattaccggacgtattattagccgaattc
actgcaaaccaaaaaacggaaaatctatcggcgatgatcaaacgctttaatgaaaccggt
tcaagccaaatcatggttgcacctgtagatcctaaagatgtgagcagctacggtatcgca
gactgcaacggcgccgaattcagcggtggcgaaagtgcggtgatttcccgcatggtcgaa
aaaccgagtccggaaaaagcaccgtcaaacttagctgttgtcggtcgttacgtgttctcc
gccaccatttgggatttattggaaagaacaccggttggtgtgggcgatgaaattcaatta
accgatgctattgatatgttaatcgccaaagaaaccgttgaagcctttcatatgaccggc
gaatcctttgactgcggcgataaaatcggctacatgaaagcttttgtcgaatacggtatt
cagcacgaaaaattaggcaacgaatttaaaaactacttaaaagcgttcgctaaaaccctg
taa

DBGET integrated database retrieval system