KEGG   Mannheimia succiniciproducens: MS0345Help
Entry
MS0345            CDS       T00201                                 

Gene name
galU
Definition
(GenBank) GalU protein
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
msu  Mannheimia succiniciproducens
Pathway
msu00040  Pentose and glucuronate interconversions
msu00052  Galactose metabolism
msu00500  Starch and sucrose metabolism
msu00520  Amino sugar and nucleotide sugar metabolism
msu01100  Metabolic pathways
msu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:msu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MS0345 (galU)
   00052 Galactose metabolism
    MS0345 (galU)
   00500 Starch and sucrose metabolism
    MS0345 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    MS0345 (galU)
Enzymes [BR:msu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MS0345 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AAU36952
UniProt: Q65VQ8
Position
complement(322746..323648)
Genome map
AA seq 300 aa AA seqDB search
MKGKTMKVIIPVAGLGTRMLPATKAIPKEMLTLVDKPLIQYVVNECIAAGVKEIVLVTHS
SKNAIENHFDTSFELETMLEKRVKRQLLEEVRSICPKDVTIMHVRQGNAKGLGHAVLCGR
PAVGNEPFAVVLPDVLLAEFTANQKTENLSAMIKRFNETGSSQIMVAPVDPKDVSSYGIA
DCNGAEFSGGESAVISRMVEKPSPEKAPSNLAVVGRYVFSATIWDLLERTPVGVGDEIQL
TDAIDMLIAKETVEAFHMTGESFDCGDKIGYMKAFVEYGIQHEKLGNEFKNYLKAFAKTL
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaggaaaaaccatgaaagttattatcccggtagccggtctgggtacgcgtatgtta
cctgcgacaaaagccattcctaaagaaatgttgactttagtcgataaacctttaatccaa
tatgtggttaacgaatgcattgcggcgggcgttaaagaaatcgtgttagttacccattcg
tcgaaaaatgctatcgaaaaccattttgacacttcatttgaactggaaaccatgctggaa
aaacgcgttaaacgtcagttgcttgaagaagtgcgttctatttgcccgaaagacgtcacc
attatgcacgtacgtcaaggtaatgcaaaaggtttaggccatgccgttttatgcggccgc
cctgccgtgggtaacgagccttttgccgtagtattaccggacgtattattagccgaattc
actgcaaaccaaaaaacggaaaatctatcggcgatgatcaaacgctttaatgaaaccggt
tcaagccaaatcatggttgcacctgtagatcctaaagatgtgagcagctacggtatcgca
gactgcaacggcgccgaattcagcggtggcgaaagtgcggtgatttcccgcatggtcgaa
aaaccgagtccggaaaaagcaccgtcaaacttagctgttgtcggtcgttacgtgttctcc
gccaccatttgggatttattggaaagaacaccggttggtgtgggcgatgaaattcaatta
accgatgctattgatatgttaatcgccaaagaaaccgttgaagcctttcatatgaccggc
gaatcctttgactgcggcgataaaatcggctacatgaaagcttttgtcgaatacggtatt
cagcacgaaaaattaggcaacgaatttaaaaactacttaaaagcgttcgctaaaaccctg
taa

DBGET integrated database retrieval system