KEGG   Mannheimia succiniciproducens: MS0377Help
Entry
MS0377            CDS       T00201                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
msu  Mannheimia succiniciproducens
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:msu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MS0377 (pfkA)
   01230 Biosynthesis of amino acids
    MS0377 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MS0377 (pfkA)
   00030 Pentose phosphate pathway
    MS0377 (pfkA)
   00051 Fructose and mannose metabolism
    MS0377 (pfkA)
   00052 Galactose metabolism
    MS0377 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    MS0377 (pfkA)
Enzymes [BR:msu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MS0377 (pfkA)
Protein phosphatases and associated proteins [BR:msu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MS0377 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
347749..348714
Genome map
AA seq 321 aa AA seqDB search
MIKKIAVLTSGGDAPGMNAAIRGVVRSALFEGLEVFGVYDGYYGLYHNKIKQLNRYSVSD
VITRGGTFLGSARFPEFKNPEVRAKCAEILRSHGIDALVVIGGDGSYTGAKLLTEEHGIQ
CIGLPGTIDNDAPGTDYTIGYQTALETAVDAIDRLRDTSSSHQRISIVEIMGRHCSDLTI
NAALAGGCEYIVASEVEFDQEELIQQIERSIANGKRHAIIAITELITDVHELAKRIEERV
HHETRATVLGHVQRGGSPCAFDRILASRMGVYAVDLLLQGKGGYCVGIQNEQLVHHDIID
AINNMRRSFKAELLDMNERLF
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaaattgctgtattgacaagtggtggcgatgcacccggcatgaatgccgcg
attcgcggcgttgtgcgttctgcattgtttgaaggattggaagtatttggcgtctatgac
ggttattatgggctataccataataaaatcaaacaattgaaccgttatagcgtatccgat
gttattaccagagggggcactttcttgggttctgcacgtttcccggaatttaaaaatcct
gaagtgcgggcaaaatgtgcagaaattttacgttctcatggtattgatgcattagtcgta
atcggcggtgacggttcatataccggggctaaattattaaccgaagaacatggcatccaa
tgtataggtttgccgggtactattgataatgacgcaccgggtacggactatacgattggt
tatcaaaccgcattagaaacggcggttgatgcgattgaccgtttacgtgatacctcaagt
tcgcaccaacgtatttctattgtggagattatggggcgccattgcagcgatttgacgatt
aatgctgcgcttgccggtggatgtgaatatattgtggcttcggaagtcgaatttgatcaa
gaggaattaattcaacaaattgagcgcagcattgctaatggtaaacgccacgcaattatt
gcaataacggaattaattactgatgttcatgagttagctaaaagaattgaagaacgcgtt
caccatgaaacccgtgccacagtattaggtcatgttcaacgcggcggttctccttgtgct
tttgaccgtattcttgcatcccgtatgggggtttatgcggttgatttgttattacaaggt
aaaggcggatattgtgtcggtattcaaaacgagcaattagtccatcatgatatcattgac
gcaatcaataacatgagacgttcatttaaggctgaattgttagacatgaacgagagatta
ttctaa

DBGET integrated database retrieval system