KEGG   Mannheimia succiniciproducens: MS0379Help
Entry
MS0379            CDS       T00201                                 

Gene name
tpiA
Definition
TpiA protein
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
msu  Mannheimia succiniciproducens
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:msu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MS0379 (tpiA)
   01230 Biosynthesis of amino acids
    MS0379 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MS0379 (tpiA)
   00051 Fructose and mannose metabolism
    MS0379 (tpiA)
   00562 Inositol phosphate metabolism
    MS0379 (tpiA)
Enzymes [BR:msu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MS0379 (tpiA)
Exosome [BR:msu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MS0379 (tpiA)
  Exosomal proteins of bladder cancer cells
   MS0379 (tpiA)
  Exosomal proteins of melanoma cells
   MS0379 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(348824..349606)
Genome map
AA seq 260 aa AA seqDB search
MKKYYFGTNLKMYKGIADTTRFLAQLSELTHDIRANNDIELFVIPSYTAIQSAIQTTLAT
SHDNPIIIGAQNMNPNDNGQYTGDISPLMLKEIGTQLVMIGHSERRHKFGETDRQENEKV
LSALKHDLTTLLCVGETLEQKNYNISDEVLRTQLKIGLSGINTNQLAKLRIAYEPVWAIG
ESGIPATADYANEKHAVIKQCLIELFGDAGKDIPVFYGGSVNAENSNELFGQQYIDGLFI
GRSAWDAENFFKIIERIVNK
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagtattattttggtaccaatctcaaaatgtacaaaggaatagccgatacaact
cggtttttagcccaactctccgaattaactcatgatattcgggctaataacgatatagaa
ttatttgtcattccgtcttataccgctatccaatccgctattcaaaccacactagccact
tctcatgataatccgattattattggcgctcaaaatatgaatcctaacgataacgggcaa
tatacaggagatatttcaccattaatgctgaaagaaataggaactcaattggtaatgatc
gggcattccgaaagacgccacaaatttggcgaaacagatcggcaggaaaatgaaaaagta
ctatcggctttaaaacatgatctaacgacactactttgcgttggcgaaacacttgaacaa
aaaaattataatatttccgacgaagtattaagaactcaattgaaaataggtctatcggga
attaatacaaatcaattagccaaactaagaatagcttatgaacccgtatgggcaattggt
gaaagcggcattcctgccaccgcagattatgcgaatgaaaaacatgcagttattaaacaa
tgtttaattgagttatttggtgacgcgggaaaagatattcccgttttctacggcggtagc
gttaatgcggaaaactcgaatgaactattcggacaacaatatattgacgggctatttata
ggtcgtagtgcttgggatgcagaaaacttcttcaaaattattgaacgtatcgttaataaa
taa

DBGET integrated database retrieval system